EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02121 - IP_trans)
FAM  PF02121
PID  IP_trans
DES  Phosphatidylinositol transfer protein
IPR  IPR001666
ANO  5
ALN  265
AID  0.543725
APH  (O62119_CAEEL/1-253:0.29378,O02434_DROME/1-263:0.27238,((PIPNA_HUMAN/1-253:0.09043,PIPNB_MOUSE/1-253:0.14714):0.69219,O00562_HUMAN/1-252:0.11416):0.11625);
ATP  (O62119_CAEEL/1-253,O02434_DROME/1-263,((PIPNA_HUMAN/1-253,PIPNB_MOUSE/1-253),O00562_HUMAN/1-252));
ATL  1.72633
DNO  5
DLN  795
DID  0.568748
DPH  (O62119_CAEEL/1-253:0.33310,O02434_DROME/1-263:0.24390,((PIPNA_HUMAN/1-253:0.12599,PIPNB_MOUSE/1-253:0.19915):0.42006,O00562_HUMAN/1-252:0.16783):0.08931);
DTP  (O62119_CAEEL/1-253,O02434_DROME/1-263,((PIPNA_HUMAN/1-253,PIPNB_MOUSE/1-253),O00562_HUMAN/1-252));
DTL  1.57934
RID  0.543725
RPH  (O62119_CAEEL/1-253:0.29378,O02434_DROME/1-263:0.27238,((PIPNA_HUMAN/1-253:0.09043,PIPNB_MOUSE/1-253:0.14714):0.69219,O00562_HUMAN/1-252:0.11416):0.11625);
RTP  (O62119_CAEEL/1-253,O02434_DROME/1-263,((PIPNA_HUMAN/1-253,PIPNB_MOUSE/1-253),O00562_HUMAN/1-252));
RTL  1.72633
LNK  O00562_HUMAN/1-252:O00562:X98654
LNK  O02434_DROME/1-263:O02434:Y08035
LNK  O62119_CAEEL/1-253:O62119:Z46381
LNK  PIPNA_HUMAN/1-253:Q00169:M73704
LNK  PIPNB_MOUSE/1-253:P53811:U46934
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...........................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O62119_CAEEL/1-253
ASQ  MLIKEYRILLPMTVQEYRIAQLYMIQKKSRLDSHGQDSGVEIISNKPYTDGPGGSGQYTFKIYHIGSRIPAWIRTVLPTNALEAHEESWNAYPVTKTRYSTP-MMDRFSLEVETLYFDDHGQQENVFNLNEKDKSTRIIDYMDFVK-DPISSHDYCAEEDPKLYRSETTNRGPLNDDWVAEHLKKG-.........LPIMCAYKLCKVEFRYWGMQTRAERWIHDLALRNTMMRAHRQAWAWQDEWTGLTMNDIRKLEAEAALHL
DSQ  ATGCTGATCAAAGAATACCGTATCCTGTTACCGATGACGGTACAGGAGTACCGCATCGCTCAGTTGTATATGATACAGAAAAAAAGTCGTCTGGATTCTCACGGTCAAGATTCAGGAGTAGAGATCATTAGCAACAAGCCGTATACAGATGGACCCGGTGGCAGTGGACAGTATACATTTAAGATCTATCATATTGGAAGTAGAATTCCCGCCTGGATCCGAACAGTGCTCCCAACAAACGCATTAGAAGCACATGAAGAATCATGGAATGCATATCCAGTGACAAAGACACGGTATTCAACCCCA---ATGATGGATAGGTTCAGTCTGGAAGTTGAGACACTCTATTTCGATGATCATGGTCAACAGGAGAATGTGTTCAATTTGAACGAAAAGGACAAATCTACTCGAATAATTGATTATATGGATTTTGTGAAA---GATCCCATTTCATCACATGATTATTGTGCAGAAGAAGATCCAAAGCTCTATCGTTCCGAGACAACAAATCGAGGACCATTAAATGACGATTGGGTTGCAGAACATTTGAAGAAAGGT---...........................CTACCCATTATGTGTGCGTATAAATTATGTAAAGTCGAGTTTCGATACTGGGGTATGCAGACGAGAGCCGAGAGATGGATTCATGATTTGGCACTGAGGAATACCATGATGAGAGCACATCGACAGGCGTGGGCGTGGCAGGATGAATGGACTGGGCTCACGATGAATGACATCCGGAAACTGGAAGCGGAAGCCGCATTACATTTG
TRN  10010101100011000
NAM  O02434_DROME/1-263
ASQ  MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAMECYPYTRTRYTCP-FVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVK-DQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKgkkqptprnMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLAL
DSQ  ATGCTGATCAAGGAGTACCGCATTCCGCTGCCCCTCACCGTCGAGGAGTACCGCATCGCCCAGCTCTACATGATTGCGAAAAAGAGTCGCGAGGAGAGCCATGGCGAGGGCAGTGGCGTTGAGATAATCATCAATGAGCCGTACAAGGATGGACCCGGCGGTAATGGTCAATACACAAAGAAGATCTATCACGTGGGCAATCATCTGCCTGGCTGGATTAAAAGTCTCTTGCCGAAAAGCGCTTTAACCGTGGAGGAGGAGGCCATGGAATGCTATCCGTATACCAGGACTCGCTACACCTGTCCG---TTTGTGGAGAAATTCTCGCTGGATATTGAGACATACTATTATCCGGACAATGGCTATCAGGACAATGTCTTCCAGCTGTCCGGAAGCGATTTGCGTAATCGGATCGTAGACGTAATTGACATTGTCAAG---GATCAGCTGTGGGGCGGTGACTATGTGAAGGAGGAGGATCCCAAGCACTTTGTGTCGGACAAGACGGGCCGTGGACCCTTGGCCGAGGATTGGCTGGAGGAGTATTGGCGCGAAGTGAAGggcaaaaagcaaccgacaccgcgcaacATGTCCCTGATGACCGCCTACAAGATCTGCCGCGTGGAGTTTCGCTACTGGGGCATGCAGACAAAGCTGGAGAAGTTCATCCACGATGTGGCGCTGCGCAAGATGATGCTGCGGGCCCATCGGCAGGCGTGGGCATGGCAGGACGAGTGGTTCGGCTTGACCATCGAGGATATACGCGAGCTGGAGCGACAGACGCAACTGGCCCTG
TRN  10010101100011010
NAM  O00562_HUMAN/1-252
ASQ  MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCP-FVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVR-DAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTG-.........-PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMADIRALEEETARML
DSQ  ATGCTCATCAAGGAATACCACATTCTGCTGCCCATGAGCCTGGACGAGTACCAGGTGGCCCAGCTCTACATGATCCAGAAAAAGAGCCGGGAGGAGTCTAGTGGTGAGGGCAGCGGCGTGGAGATCCTGGCCAACCGGCCCTACACGGATGGGCCCGGGGGCAGCGGGCAATACACACACAAGGTGTACCACGTGGGCTCCCACATCCCAGGCTGGTTCCGGGCACTGCTGCCCAAGGCTGCCCTGCAGGTAGAAGAGGAATCCTGGAATGCCTACCCCTACACCCGAACCCGGTACACCTGCCCT---TTCGTGGAGAAATTCTCCATTGAAATTGAGACCTATTACCTGCCTGATGGGGGGCAGCAGCCAAACGTCTTCAACCTGAGCGGGGCCGAGAGGAGACAGCGCATCCTGGACACCATCGACATCGTGCGG---GATGCAGTGGCCCCAGGCGAGTACAAAGCAGAAGAGGACCCCCGGCTTTATCACTCGGTCAAGACGGGCCGAGGGCCACTGTCTGATGACTGGGCACGGACGGCGGCACAGACGGGG---...........................---CCCCTTATGTGTGCCTATAAGCTGTGCAAGGTTGAGTTCCGCTACTGGGGCATGCAAGCCAAGATCGAGCAGTTCATCCATGATGTAGGTCTGCGTCGGGTGATGCTGCGGGCCCACCGCCAGGCCTGGTGCTGGCAGGATGAGTGGACAGAGCTGAGCATGGCTGACATCCGGGCACTGGAAGAGGAGACTGCTCGCATGCTG
TRN  10010101100011011
NAM  PIPNB_MOUSE/1-253
ASQ  VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGG-GEGIEVLKNEPYEND-GEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPLGPNWKKELANTPD.........CPRMCAYKLVTIKFKWWGLQSKVENFIQKQ-EKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKEL
DSQ  GTGCTGATTAAGGAATTCCGTGTGGTTTTGCCGTGTTCTGTTCAAGAGTATCAGGTTGGACAGCTTTACTCTGTTGCAGAAGCGAGTAAGAATGAAACTGGTGGT---GGAGAAGGAATCGAAGTCCTGAAGAATGAACCTTACGAAAACGAT---GGCGAGAAGGGACAGTACACACACAAAATCTACCACCTGAAGAGCAAAGTTCCTGCATTTGTGAGGATGATTGCTCCGGAGGGCTCCCTGGTGTTTCATGAGAAAGCCTGGAATGCCTACCCCTACTGCAGAACAATTGTAACGAATGAATACATGAAAGATGACTTCTTCATCAAAATTGAAACATGGCACAAACCTGACTTGGGAACATTAGAAAATGTTCACGGTTTAGATCCCAACACTTGGAAAACTGTTGAAATAGTCCACATAGACATTGCAGATCGAAGTCAAGTTGAACCAGCAGACTACAAAGCTGATGAAGACCCTGCATTATTCCATTCAGTCAAGACCAAGAGAGGACCCCTGGGACCTAACTGGAAGAAGGAGCTGGCAAACACCCCTGAC...........................TGTCCTAGGATGTGTGCCTATAAGCTGGTGACCATCAAGTTCAAGTGGTGGGGGCTGCAGAGCAAAGTAGAGAACTTTATCCAGAAGCAA---GAAAAACGGATATTTACGAACTTACATCGCCAGCTCTTTTGTTGGATTGACAAGTGGATTGACCTGACAATGGAAGACATTAGGCGAATGGAGGATGAGACTCAGAAAGAACTA
TRN  10010101100011000
NAM  PIPNA_HUMAN/1-253
ASQ  VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGG-GEGVEVLVNEPYEKD-GEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKD.........CPYMCAYKLVTVKFKWWGLQNKVENFIHKQ-ERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQL
DSQ  GTGCTGCTCAAGGAGTATCGAGTAATCCTGCCTGTGTCTGTAGATGAGTATCAAGTGGGGCAGCTGTATTCTGTGGCTGAGGCCAGTAAAAATGAAACGGGTGGT---GGCGAAGGCGTGGAGGTCCTGGTGAATGAGCCCTACGAGAAGGAC---GGTGAGAAAGGCCAGTACACACACAAGATCTACCACCTGCAGAGCAAAGTACCCACGTTTGTTCGAATGCTGGCCCCAGAGGGAGCCCTGAATATACACGAGAAAGCCTGGAATGCTTACCCCTACTGCAGAACCGTTATTACAAATGAGTACATGAAAGAAGACTTTCTGATTAAAATTGAAACCTGGCACAAACCAGATCTTGGCACGCAGGAGAATGTGCATAAGCTGGAGCCTGAGGCGTGGAAACACGTGGAAGCCGTATATATAGACATTGCAGATCGAAGCCAAGTGCTCAGCAAGGATTACAAGGCAGAGGAAGACCCAGCAAAATTTAAATCTATCAAAACAGGCCGAGGACCCTTGGGCCCCAATTGGAAGCAAGAGCTTGTAAACCAGAAGGAC...........................TGCCCATATATGTGTGCATACAAACTGGTGACCGTCAAGTTCAAGTGGTGGGGCCTGCAGAACAAAGTGGAGAACTTCATCCATAAGCAA---GAGAGGCGTCTGTTTACAAACTTCCACAGGCAGCTGTTCTGTTGGCTCGATAAGTGGGTTGACCTGACCATGGACGACATTCGAAGGATGGAAGAAGAGACGAAGAGACAGCTG
TRN  10010101100011011
//