EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02120 - Flg_hook)
FAM  PF02120
PID  Flg_hook
DES  Flagellar hook-length control protein
IPR  IPR001635
ANO  15
ALN  150
AID  0.194747
APH  (((Q9KQ73_VIBCH/480-623:0.27992,Q9Z6G3_VIBPA/448-591:0.52920):0.15518,(O34003_RHOSH/519-661:1.50160,((Q9KA38_BACHD/208-351:1.53599,((Q97H56_CLOAB/267-410:1.13433,FLIK_BACSU/233-381:0.90390):0.00000,Q44769_BORBU/203-347:1.65242):0.33804):0.43948,Q9WZE0_THEMA/463-606:1.60626):0.34718):0.24292):0.18219,((Q9I3Q6_PSEAE/229-372:0.33746,Q9R9Y0_PSEPU/225-369:0.40651):0.42794,(FLIK_BUCAI/46-190:1.73636,(FLIK_ECOLI/181-324:0.31394,FLIK_SALTY/212-355:0.22061):0.36393):0.62738):0.20919,(P74952_VIBPA/174-317:0.60248,Q9AES7_AERHY/180-323:0.65468):0.84643);
ATP  (((Q9KQ73_VIBCH/480-623,Q9Z6G3_VIBPA/448-591),(O34003_RHOSH/519-661,((Q9KA38_BACHD/208-351,((Q97H56_CLOAB/267-410,FLIK_BACSU/233-381),Q44769_BORBU/203-347)),Q9WZE0_THEMA/463-606))),((Q9I3Q6_PSEAE/229-372,Q9R9Y0_PSEPU/225-369),(FLIK_BUCAI/46-190,(FLIK_ECOLI/181-324,FLIK_SALTY/212-355))),(P74952_VIBPA/174-317,Q9AES7_AERHY/180-323));
ATL  17.5955
DNO  15
DLN  450
DID  0.344676
DPH  ((((O34003_RHOSH/519-661:0.75706,(Q9I3Q6_PSEAE/229-372:0.21128,Q9R9Y0_PSEPU/225-369:0.33006):0.17811):0.16781,(((Q9WZE0_THEMA/463-606:0.74273,(FLIK_BACSU/233-381:0.71664,(Q9KA38_BACHD/208-351:0.82602,((FLIK_BUCAI/46-190:0.76601,Q44769_BORBU/203-347:0.41498):0.27427,Q97H56_CLOAB/267-410:0.48368):0.21119):0.14395):0.20269):0.31486,Q9KQ73_VIBCH/480-623:0.26043):0.11376,Q9Z6G3_VIBPA/448-591:0.33858):0.39264):0.07659,(P74952_VIBPA/174-317:0.52888,Q9AES7_AERHY/180-323:0.41938):0.36081):0.48035,FLIK_ECOLI/181-324:0.27843,FLIK_SALTY/212-355:0.24364);
DTP  ((((O34003_RHOSH/519-661,(Q9I3Q6_PSEAE/229-372,Q9R9Y0_PSEPU/225-369)),(((Q9WZE0_THEMA/463-606,(FLIK_BACSU/233-381,(Q9KA38_BACHD/208-351,((FLIK_BUCAI/46-190,Q44769_BORBU/203-347),Q97H56_CLOAB/267-410)))),Q9KQ73_VIBCH/480-623),Q9Z6G3_VIBPA/448-591)),(P74952_VIBPA/174-317,Q9AES7_AERHY/180-323)),FLIK_ECOLI/181-324,FLIK_SALTY/212-355);
DTL  10.3454
RID  0.194747
RPH  (((Q9KQ73_VIBCH/480-623:0.27992,Q9Z6G3_VIBPA/448-591:0.52920):0.15518,(O34003_RHOSH/519-661:1.50160,((Q9KA38_BACHD/208-351:1.53599,((Q97H56_CLOAB/267-410:1.13433,FLIK_BACSU/233-381:0.90390):0.00000,Q44769_BORBU/203-347:1.65242):0.33804):0.43948,Q9WZE0_THEMA/463-606:1.60626):0.34718):0.24292):0.18219,((Q9I3Q6_PSEAE/229-372:0.33746,Q9R9Y0_PSEPU/225-369:0.40651):0.42794,(FLIK_BUCAI/46-190:1.73636,(FLIK_ECOLI/181-324:0.31394,FLIK_SALTY/212-355:0.22061):0.36393):0.62738):0.20919,(P74952_VIBPA/174-317:0.60248,Q9AES7_AERHY/180-323:0.65468):0.84643);
RTP  (((Q9KQ73_VIBCH/480-623,Q9Z6G3_VIBPA/448-591),(O34003_RHOSH/519-661,((Q9KA38_BACHD/208-351,((Q97H56_CLOAB/267-410,FLIK_BACSU/233-381),Q44769_BORBU/203-347)),Q9WZE0_THEMA/463-606))),((Q9I3Q6_PSEAE/229-372,Q9R9Y0_PSEPU/225-369),(FLIK_BUCAI/46-190,(FLIK_ECOLI/181-324,FLIK_SALTY/212-355))),(P74952_VIBPA/174-317,Q9AES7_AERHY/180-323));
RTL  17.5955
LNK  FLIK_BACSU/233-381:P23451:X56049
LNK  FLIK_BUCAI/46-190:P57181:AP001118
LNK  FLIK_ECOLI/181-324:P52614:L43491
LNK  FLIK_SALTY/212-355:P26416:L43492
LNK  O34003_RHOSH/519-661:O34003:U86454
LNK  P74952_VIBPA/174-317:P74952:U52957
LNK  Q44769_BORBU/203-347:Q44769:AE001137
LNK  Q97H56_CLOAB/267-410:Q97H56:AE007716
LNK  Q9AES7_AERHY/180-323:Q9AES7:AY028400
LNK  Q9I3Q6_PSEAE/229-372:Q9I3Q6:AE004574
LNK  Q9KA38_BACHD/208-351:Q9KA38:BA000004
LNK  Q9KQ73_VIBCH/480-623:Q9KQ73:AE004285
LNK  Q9R9Y0_PSEPU/225-369:Q9R9Y0:AF031418
LNK  Q9WZE0_THEMA/463-606:Q9WZE0:AE001740
LNK  Q9Z6G3_VIBPA/448-591:Q9Z6G3:AF069392
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.x.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9WZE0_THEMA/463-606
ASQ  SEKPLFQNREKNQPMEMKMKYEEKGKIESYREITNREALEFLSQERAKQVYSLPELKRTETVHLPRFV-EQM.-.-YYHKTERAVIDLEPPELGKLEITITKEENQL.KIVFRVQTEEAKHVLEHDIPRLIERFNEKGFDVQVYVEKQEE
DSQ  TCTGAAAAACCACTCTTTCAAAACCGAGAGAAAAATCAACCAATGGAAATGAAAATGAAGTACGAAGAGAAAGGAAAAATCGAAAGTTACAGAGAAATAACAAACAGGGAAGCGCTGGAGTTTCTGTCTCAGGAAAGGGCGAAGCAGGTTTACTCACTCCCCGAATTGAAAAGAACAGAGACCGTTCATCTACCAAGGTTTGTG---GAACAGATG...---...---TACTACCACAAGACAGAAAGGGCCGTCATAGACCTCGAGCCACCGGAGTTGGGAAAACTGGAGATCACCATAACAAAGGAAGAGAACCAGCTG...AAAATAGTTTTCAGAGTTCAGACAGAAGAAGCCAAGCACGTTTTAGAACACGACATACCGCGGTTGATCGAGAGATTCAACGAAAAGGGATTCGATGTGCAGGTCTACGTCGAAAAACAGGAGGAA
TRN  10010101100011000
NAM  O34003_RHOSH/519-661
ASQ  VGQDGAETALAVEPAGATLAGSDPVAPAPLTALPSDLRLERAGEPRAGADGPLALAAPDAPAELQDRILE--.-.-AAAGEGEIEIVLAPETLGRLRIRVEMRDGTA.QVSFTTETAEAARLLSGQEGRLSDLLEKHGLSLGRHEAGQGD
DSQ  GTCGGACAGGACGGGGCAGAGACGGCTCTGGCCGTGGAGCCCGCCGGGGCCACTCTCGCCGGGTCAGATCCGGTGGCCCCCGCCCCCCTGACCGCCCTTCCGAGCGACCTGCGCCTCGAGCGGGCGGGCGAGCCCCGGGCGGGCGCGGACGGGCCCCTCGCCCTCGCGGCCCCCGACGCACCGGCCGAGCTGCAGGACAGGATCCTCGAG------...---...---GCCGCCGCAGGGGAGGGCGAGATCGAGATCGTGCTCGCCCCCGAGACCCTGGGCCGGCTCCGCATCCGCGTCGAGATGCGCGACGGCACCGCG...CAGGTGAGCTTCACCACCGAAACGGCCGAGGCCGCCCGTCTCCTGTCGGGGCAGGAAGGACGCCTGTCGGACCTCCTTGAGAAGCACGGCCTGTCGCTCGGCCGGCACGAGGCCGGACAGGGCGAC
TRN  10010101100011001
NAM  Q9Z6G3_VIBPA/448-591
ASQ  LSAGALKATASQQDKPESQYGLAGQLQAAAGQQGVTAQQQTRAEAAQQAQLPLQLTKELANEQVAEKV-QMM.-.-MSKNLKNLDIRLDPPELGRMQIRMTMNNDLA.NVHFTVTNPQARDIIEQTLPRLREMLAQQGMQLADSSVQQQS
DSQ  TTAAGTGCAGGTGCGTTGAAAGCTACGGCGAGCCAGCAAGATAAGCCAGAGTCGCAATACGGATTAGCAGGACAGTTGCAAGCGGCCGCTGGGCAACAAGGTGTAACAGCCCAACAGCAAACCCGAGCGGAAGCCGCTCAGCAAGCACAACTGCCTCTGCAATTAACAAAAGAACTCGCTAATGAGCAAGTGGCGGAAAAAGTA---CAAATGATG...---...---ATGTCGAAGAACTTGAAGAACCTCGACATCCGACTTGACCCACCAGAGCTTGGCCGTATGCAAATTCGCATGACGATGAACAACGATTTGGCC...AACGTGCATTTTACGGTTACCAACCCACAAGCGCGTGACATTATTGAACAAACGTTGCCTCGTCTACGTGAAATGTTGGCTCAACAAGGGATGCAACTGGCGGATTCCTCGGTTCAGCAGCAAAGC
TRN  11011101101011010
NAM  Q9KQ73_VIBCH/480-623
ASQ  RALAGSDERRAVSESGQEDLAQQIAAAAGQGTAQNQALNRAESQLVQTNATPVPLNKEMAADQLAERV-QMM.-.-MSKNLKNIDIRLDPPELGRMHIRMNMQGDGA.TVHFTVANQHAREALEQTMPRLREMLAQQGVQLGDTSVQQQS
DSQ  CGAGCTTTAGCGGGCAGTGACGAACGTCGTGCGGTCAGTGAATCAGGACAAGAAGACTTAGCCCAGCAAATCGCAGCGGCAGCAGGACAAGGTACGGCGCAAAACCAAGCTCTCAACCGCGCTGAGTCGCAACTGGTACAAACCAATGCTACCCCTGTTCCATTGAATAAAGAGATGGCTGCCGATCAGTTGGCTGAACGTGTG---CAGATGATG...---...---ATGTCGAAGAACTTGAAAAATATTGATATTCGGCTGGATCCACCGGAATTGGGACGGATGCATATTCGCATGAACATGCAAGGTGATGGCGCG...ACCGTGCATTTCACCGTCGCGAACCAACACGCACGTGAGGCATTAGAACAAACCATGCCAAGGCTGCGTGAAATGTTGGCGCAGCAAGGCGTCCAATTGGGCGATACCTCGGTTCAGCAGCAAAGT
TRN  10010101100011000
NAM  Q9R9Y0_PSEPU/225-369
ASQ  GSLLEDGLKDTKSASSDTRIDDFANRLASLTQAATAKTANAVPANANPLHQPLPMNQNAWAEGLVNRV-MYL.-.-SSQNLKSADIQLEPAELGRLDIRVNVAADQAtQVTFISGHAGVRDALDSQVHRLRELFAQQGLAQPDVNVADQS
DSQ  GGCAGCTTGCTTGAGGACGGCCTGAAAGACACCAAGAGTGCCAGCAGCGACACCCGCATCGATGATTTTGCCAACCGCCTGGCCAGCCTGACCCAGGCGGCCACGGCCAAGACCGCCAATGCCGTGCCGGCCAATGCGAACCCGCTGCATCAGCCATTGCCAATGAACCAGAACGCTTGGGCAGAAGGCCTGGTCAACCGGGTC---ATGTACCTG...---...---TCCAGCCAGAACCTCAAGTCGGCTGATATCCAACTGGAGCCAGCAGAACTCGGTCGCCTCGACATTCGCGTCAATGTTGCGGCGGACCAGGCCaccCAGGTCACCTTCATCAGCGGCCACGCCGGCGTACGTGATGCCCTCGACAGCCAGGTGCATCGCCTGCGCGAACTGTTTGCCCAGCAGGGGTTGGCGCAGCCGGATGTCAACGTGGCTGACCAGTCG
TRN  11011101101011011
NAM  Q9I3Q6_PSEAE/229-372
ASQ  PAVASAASESLLESKAEPRGEPFAAKLNGLTQAMAQQALTNRPVNGTVPGQPVAMQQNGWSEAVVDRV-MWM.-.-SSQNLKSAEIQLDPAELGRLDVRIHMTADQT.QVTFASPNAGVRDALESQMHRLRDMFSQQGMNQLDVNVSDQS
DSQ  CCGGCCGTCGCCAGCGCCGCCTCCGAGAGCCTGCTGGAGAGCAAGGCGGAACCCCGCGGTGAACCTTTCGCGGCCAAGCTCAACGGGCTGACCCAGGCCATGGCGCAACAGGCCCTGACCAACCGTCCGGTGAACGGCACGGTGCCCGGCCAGCCGGTGGCGATGCAGCAGAACGGCTGGAGCGAGGCGGTGGTGGACCGGGTG---ATGTGGATG...---...---TCCAGCCAGAACCTGAAGTCGGCGGAGATCCAGCTCGACCCCGCCGAGCTGGGACGCCTGGACGTGCGCATCCACATGACCGCCGACCAGACC...CAGGTGACCTTCGCCAGTCCCAACGCCGGCGTTCGCGACGCCCTGGAAAGCCAGATGCACCGGCTGCGCGACATGTTCAGCCAGCAGGGCATGAACCAGCTCGACGTGAACGTCTCCGACCAGTCG
TRN  11011111101111111
NAM  Q9AES7_AERHY/180-323
ASQ  LIASLQPLLGSEVPVEQEPVVPELKGAMGNLLSSPLSRPAEYQWAPAKLADNPAQWGQQLVDMLKDKV-ELQ.-.-VNQQIKQAHIRLDPPELGRLELTVRVDGDRL.NVQLNVSNPAVRDALIQSMERLRMSLAPHHAGGVEVNVGQGS
DSQ  CTGATAGCAAGTTTGCAGCCCTTGCTGGGCAGTGAGGTGCCAGTGGAGCAGGAACCTGTTGTACCCGAGCTCAAGGGGGCGATGGGAAACCTGTTGTCATCGCCTCTTTCCAGGCCGGCGGAGTATCAATGGGCCCCCGCCAAGTTGGCCGATAACCCGGCGCAGTGGGGCCAGCAACTGGTAGATATGTTGAAGGACAAGGTT---GAGCTCCAG...---...---GTCAATCAACAGATCAAGCAAGCACATATCCGTCTTGACCCACCTGAGCTGGGGCGGCTTGAACTGACAGTTCGGGTCGATGGTGACCGTCTC...AACGTTCAGCTCAATGTAAGCAATCCTGCTGTGCGAGATGCATTGATCCAGTCAATGGAGCGACTGCGAATGAGCTTGGCCCCCCATCATGCTGGTGGTGTCGAGGTCAATGTTGGTCAGGGAAGC
TRN  10010101100011001
NAM  P74952_VIBPA/174-317
ASQ  QALLNQPAQGQATTAPLNVQTSAPSAQAVSTATVAHAHTQGSEWAAVKVDTSAGKWGEQMMQVLHDRV-TLQ.-.-AQQSVQEAKIRLDPPDLGKLDLLVRVEGDRL.SVQINANTAATREALMQVSERLRTELQEQNFVHVDVNVGADQ
DSQ  CAAGCATTGTTGAACCAACCAGCGCAAGGGCAAGCAACGACTGCACCACTGAACGTTCAAACTTCTGCTCCGTCCGCTCAAGCAGTGAGCACTGCGACAGTGGCTCATGCTCATACGCAAGGCTCAGAGTGGGCAGCAGTGAAAGTGGACACAAGTGCAGGCAAATGGGGAGAGCAGATGATGCAGGTGCTGCATGACCGAGTC---ACCTTGCAA...---...---GCACAGCAAAGTGTTCAGGAAGCGAAAATCCGTCTCGATCCGCCCGATCTAGGCAAACTGGATTTACTCGTTCGTGTTGAGGGCGATCGATTG...AGCGTACAGATCAACGCAAACACGGCGGCAACACGTGAAGCCTTGATGCAAGTATCGGAACGCTTACGCACTGAACTACAAGAACAAAACTTCGTCCATGTTGATGTCAATGTAGGTGCCGACCAA
TRN  11011101101011000
NAM  FLIK_SALTY/212-355
ASQ  PALTPLVVAAAATSAKVEVDSPPAPVTHGAAMPTLSSATAQPLPVASAPVLSAPLGSHEWQQTFSQQV-MLF.-.-TRQGQQSAQLRLHPEELGQVHISLKLDDNQA.QLQMVSPHSHVRAALEAALPMLRTQLAESGIQLGQSSISSES
DSQ  CCAGCACTGACGCCGCTGGTAGTCGCTGCCGCCGCGACCAGCGCGAAAGTGGAGGTGGATAGCCCGCCCGCGCCAGTAACGCATGGCGCGGCAATGCCGACGCTCAGCAGCGCCACGGCGCAACCGCTACCTGTCGCCTCAGCCCCGGTACTCAGCGCGCCGTTAGGCAGCCATGAATGGCAGCAAACGTTCAGTCAGCAGGTC---ATGTTATTT...---...---ACGCGTCAGGGACAGCAAAGCGCGCAGCTTCGATTGCATCCGGAAGAGTTAGGTCAGGTGCATATTTCGCTCAAGCTGGATGACAATCAGGCG...CAGCTCCAGATGGTATCGCCGCACAGCCATGTCCGCGCCGCGCTGGAAGCCGCCCTGCCCATGTTGCGCACCCAGTTGGCGGAAAGCGGCATTCAGTTGGGACAAAGCAGTATCAGTAGCGAAAGC
TRN  11011101101011000
NAM  FLIK_ECOLI/181-324
ASQ  GTPAQPLTPLVAEAQSKAEVISTPSPVTAAASPLITPHQTQPLPTVAAPVLSAPLGSHEWQQSLSQHI-SLF.-.-TRQGQQSAELRLHPQDLGEVQISLKVDDNQA.QIQMVSPHQHVRAALEAALPVLRTQLAESGIQLGQSNISGES
DSQ  GGCACACCAGCTCAGCCATTAACACCGCTGGTAGCAGAAGCCCAGAGTAAAGCGGAAGTCATCAGCACACCTTCACCGGTGACCGCTGCCGCCAGCCCGCTAATCACTCCACACCAGACACAGCCACTGCCCACCGTCGCCGCACCTGTTTTGAGTGCACCGCTGGGTTCTCACGAATGGCAACAATCATTAAGCCAGCATATT---TCGCTGTTC...---...---ACCCGCCAGGGGCAACAAAGTGCAGAGTTGCGTCTGCACCCGCAGGATTTAGGTGAAGTGCAAATCTCCCTCAAAGTGGATGATAACCAGGCG...CAAATCCAGATGGTTTCACCGCATCAGCATGTACGCGCCGCCCTGGAAGCAGCGCTGCCGGTACTGCGCACGCAGCTGGCCGAAAGTGGCATTCAGTTAGGGCAAAGCAACATCAGTGGCGAAAGC
TRN  11011101101011000
NAM  Q44769_BORBU/203-347
ASQ  FSLNAIDGQNFVDRYKVKEISNDSLKGFVEEFANYNIKSSKDVGGFDFVSSLKPEWNLKINKNIVDKAKVVL.-.-KSNNTGEIKLVLKPKELGSIRINLNLDSNNNlLGKIVVDNQNVKMLFDQNMHSLNKMLGESGFN-ASLNLFLAG
DSQ  TTTAGCTTAAATGCAATTGATGGTCAAAATTTTGTTGATAGGTATAAAGTTAAAGAAATATCAAACGATTCTTTAAAAGGCTTTGTTGAAGAATTTGCTAATTATAATATAAAAAGCTCTAAAGATGTTGGAGGCTTTGATTTTGTCAGCAGTTTAAAGCCGGAGTGGAATCTTAAGATTAATAAGAATATTGTGGATAAAGCTAAAGTTGTGTTA...---...---AAATCGAATAATACAGGAGAGATTAAGTTGGTTTTAAAGCCCAAAGAGCTTGGTAGTATACGAATTAATTTAAACCTTGATTCAAATAATAATttaTTGGGAAAGATCGTAGTGGATAATCAAAATGTTAAAATGCTTTTTGACCAAAATATGCATTCATTAAATAAAATGCTTGGTGAGAGTGGTTTTAAT---GCCAGCTTAAATCTTTTTCTTGCAGGT
TRN  10010101110011000
NAM  FLIK_BUCAI/46-190
ASQ  IILPLNIKKNKKIVFDSKNINKINPMISKRHSCKILSNKKEFIKSYIEPFMSSDTKNSIEWKKLISHKILLS.-.-ISNKYNQAKIHLKPESLGSIYVSISMKNNIA.TLKFISEHNEVKTFLDSYMPFLYNSLKKNGIKLKEFKISISS
DSQ  ATTATTTTGCCATTAAATATTAAAAAAAATAAAAAGATTGTATTTGATTCTAAAAATATCAATAAAATCAATCCCATGATCAGTAAAAGACATTCATGTAAAATTCTTTCTAATAAAAAGGAATTTATAAAATCATATATAGAACCATTTATGTCGAGCGACACAAAAAATTCTATTGAATGGAAAAAATTAATTAGTCATAAAATACTTTTATCA...---...---ATTTCTAATAAGTACAATCAAGCTAAGATACATTTGAAACCGGAATCGCTAGGGTCTATATATGTATCAATTAGCATGAAAAATAATATTGCC...ACATTAAAATTTATTTCTGAACATAATGAAGTCAAAACATTTTTAGACAGTTATATGCCTTTTTTGTATAATTCATTAAAGAAAAATGGAATTAAATTAAAAGAATTTAAGATTTCTATTTCTTCA
TRN  10010101110011000
NAM  Q9KA38_BACHD/208-351
ASQ  SRTYRPFLLANDANEGRVQGLTLQHHGQELGQALNRTQQLVIHLGEQQPKEVQQQQFLRQFQQILQRG-NVV.-.-QLQNGTQMTIKLMPEHLGRLDIQLTQTNGAI.VARIMTSTTMARELVESQMNQLRYAFTQQQLNVERIEVVQQP
DSQ  AGCCGAACGTATCGTCCGTTTTTGTTAGCCAATGATGCAAATGAAGGACGCGTGCAAGGCTTAACGCTTCAACATCATGGTCAGGAGCTAGGTCAAGCGCTTAACCGGACACAACAGCTCGTCATCCACCTCGGAGAACAGCAGCCAAAAGAAGTCCAGCAACAACAGTTTCTTCGTCAGTTTCAACAAATTTTACAACGGGGA---AATGTCGTG...---...---CAATTACAAAATGGAACACAAATGACGATTAAGCTCATGCCTGAACACCTTGGACGTTTGGATATTCAGTTAACCCAGACGAACGGTGCCATC...GTTGCGAGAATCATGACGTCGACCACGATGGCAAGGGAGCTTGTCGAATCACAAATGAATCAGTTGCGTTATGCCTTCACACAGCAACAGTTGAACGTGGAGCGAATTGAAGTTGTTCAGCAACCG
TRN  10010101110011000
NAM  Q97H56_CLOAB/267-410
ASQ  TNEQAKSGDSSENFLKNLISKDDNTESQFSKVTAFMNQFSSSAVEVQGDAKVMTANRVTFVEDMIKSV-KFM.-.-ENNNIKELTVKINPKELGEVIIKLTSEAGVM.KAELTTSNKDAYNLLNSNLNEMNKNLNEQNIKIQAFSVNVYN
DSQ  ACAAATGAACAAGCTAAGAGTGGAGATTCTAGCGAAAATTTTCTTAAAAACCTTATATCAAAGGATGACAACACTGAAAGTCAATTTTCAAAGGTTACTGCTTTTATGAATCAATTTTCTAGTAGTGCAGTTGAAGTTCAAGGAGATGCAAAGGTAATGACTGCAAATAGGGTTACTTTTGTAGAGGATATGATAAAATCAGTT---AAGTTTATG...---...---GAGAATAATAACATCAAAGAGTTAACTGTAAAAATTAATCCTAAAGAACTTGGAGAAGTTATTATAAAGCTAACTTCTGAGGCTGGAGTTATG...AAGGCAGAGCTTACAACTTCAAATAAAGATGCTTATAATCTTTTAAATTCAAATCTCAATGAAATGAATAAAAACTTAAATGAACAAAATATAAAAATACAAGCTTTTTCTGTGAATGTGTATAAT
TRN  10010101110011000
NAM  FLIK_BACSU/233-381
ASQ  TPLSQSSSSKNASDVSGSIQPVDSKSGLQMLFSGYRGIGGVQTLDLQQMSSDIPNAETKTVADQVINAWKQMkYtPFGRSTGSFTIRLNPEHLGFVTIKLTNENGMF.QSKIIASSQSAKELLEQHLPQLKQSLPNMAVQIDRFTLPVQS
DSQ  ACACCGCTCTCGCAGAGTTCATCCAGCAAAAATGCATCGGATGTTTCTGGAAGTATTCAGCCTGTAGATAGTAAATCAGGACTCCAAATGCTGTTTTCGGGGTATCGGGGCATAGGAGGAGTTCAAACACTTGATCTGCAGCAGATGTCATCTGATATACCAAATGCCGAAACAAAAACGGTGGCTGATCAAGTGATTAATGCGTGGAAGCAGATGaaaTATacgCCTTTCGGCAGATCGACGGGAAGTTTCACTATTCGGCTGAACCCTGAACATTTAGGATTTGTCACAATCAAGCTGACAAATGAAAATGGAATGTTT...CAGAGTAAAATCATAGCATCTAGCCAATCAGCAAAAGAATTGCTTGAACAGCATCTTCCTCAGCTGAAGCAATCATTGCCGAATATGGCCGTCCAAATTGACCGTTTTACTCTTCCGGTCCAAAGC
TRN  10010101100011000
//