EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02118 - Srg)
FAM  PF02118
PID  Srg
DES  C.elegans Srg family integral membrane protein
IPR  IPR000609
ANO  10
ALN  315
AID  0.306826
APH  (((SRG8_CAEEL/1-296:0.29572,SRG9_CAEEL/1-301:0.26256):0.32141,SRG3_CAEEL/1-292:0.68821):0.10683,(SRG7_CAEEL/1-300:0.94891,SRG6_CAEEL/1-297:1.01888):0.05601,(O45150_CAEEL/28-332:1.33467,(P91275_CAEEL/1-303:0.63477,((P91535_CAEEL/1-309:0.28769,SRG10_CAEEL/2-307:0.27234):0.34571,SRG13_CAEEL/1-308:0.32354):0.41856):0.15162):0.25758);
ATP  (((SRG8_CAEEL/1-296,SRG9_CAEEL/1-301),SRG3_CAEEL/1-292),(SRG7_CAEEL/1-300,SRG6_CAEEL/1-297),(O45150_CAEEL/28-332,(P91275_CAEEL/1-303,((P91535_CAEEL/1-309,SRG10_CAEEL/2-307),SRG13_CAEEL/1-308))));
ATL  7.72501
DNO  6
DLN  945
DID  0.464527
DPH  ((SRG9_CAEEL/1-301:0.39726,SRG6_CAEEL/1-297:0.55594):0.23002,((P91535_CAEEL/1-309:0.28441,SRG10_CAEEL/2-307:0.22390):0.25578,SRG13_CAEEL/1-308:0.30904):0.16936,P91275_CAEEL/1-303:0.46880);
DTP  ((SRG9_CAEEL/1-301,SRG6_CAEEL/1-297),((P91535_CAEEL/1-309,SRG10_CAEEL/2-307),SRG13_CAEEL/1-308),P91275_CAEEL/1-303);
DTL  2.89451
RID  0.332183
RPH  ((SRG9_CAEEL/1-301:0.57788,SRG6_CAEEL/1-297:1.05186):0.40320,((P91535_CAEEL/1-309:0.27918,SRG10_CAEEL/2-307:0.28156):0.32548,SRG13_CAEEL/1-308:0.34293):0.35889,P91275_CAEEL/1-303:0.69680);
RTP  ((SRG9_CAEEL/1-301,SRG6_CAEEL/1-297),((P91535_CAEEL/1-309,SRG10_CAEEL/2-307),SRG13_CAEEL/1-308),P91275_CAEEL/1-303);
RTL  4.31778
LNK  O45150_CAEEL/28-332:O45150:
LNK  P91275_CAEEL/1-303:P91275:U80444
LNK  P91535_CAEEL/1-309:P91535:U80839
LNK  SRG10_CAEEL/2-307:P46568:Z35663
LNK  SRG13_CAEEL/1-308:P46567:Z46343
LNK  SRG3_CAEEL/1-292:P46572:
LNK  SRG6_CAEEL/1-297:P54128:U13019
LNK  SRG7_CAEEL/1-300:P54129:
LNK  SRG8_CAEEL/1-296:P46565:
LNK  SRG9_CAEEL/1-301:P46566:U13019
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SRG6_CAEEL/1-297
ASQ  MANSTSFLG-----------CSRFYATFEENLKLMGQLVYLIPSFILISKMIYVIQVKHRG.DYHEQRRFWLLYTMDLALSLLNLFFDIFYYRLTLFVPQICESFSFFLRANPLLIDITYPLWFYFHVGKMVAQMSISFERMTFNLLKPNDYRRIWKHGLTACVIMIIFVPFSIIWNILISDKYIQFYFGGF----QPNYSRRVNWFGTTAWQLTYMQISMAVTLLSNIVTGAILWKSQNQSRKS-RLLCRIWFAISTEYLLSACAFCYLHMKT-FAFDYSNLIFMLVIFVWDGFNILSPVIMISMNKSLRKQVF
DSQ  ATGGCAAACTCTACTTCATTTTTGGGT---------------------------------TGTAGTCGATTTTATGCAACATTTGAAGAAAATTTAAAACTTATGGGTCAACTTGTCTATCTGATTCCATCGTTTATATTAATTTCAAAAATGATTTACGTGATACAAGTGAAACATCGAGGT...GATTATCATGAACAGAGGCGGTTTTGGTTATTATATACTATGGATTTAGCTTTGAGCCTTCTCAATCTATTTTTCGACATTTTCTACTATCGTTTGACACTTTTCGTTCCCCAAATCTGTGAATCTTTTTCATTTTTCCTCCGGGCAAACCCATTGCTTATCGACATAACATATCCTCTTTGGTTCTATTTTCATGTGGGTAAAATGGTTGCTCAAATGAGCATCAGTTTTGAGAGAATGACTTTCAACCTATTAAAACCAAATGACTATCGAAGAATATGGAAACATGGATTAACAGCTTGTGTGATAATGATAATATTTGTTCCGTTTAGTATAATTTGGAATATTCTGATATCAGACAAATATATACAGTTTTATTTTGGAGGATTT------------CAACCGAATTATTCAAGAAGAGTGAATTGGTTTGGCACTACCGCATGGCAACTAACCTATATGCAAATATCAATGGCAGTCACACTTCTGTCAAACATTGTCACAGGAGCAATTCTCTGGAAATCTCAAAACCAGAGTCGAAAATCG---AGACTCTTGTGCAGAATTTGGTTTGCAATTTCAACGGAATACTTATTAAGTGCCTGCGCATTTTGTTACTTGCATATGAAAACA---TTCGCTTTTGATTATTCCAATCTTATCTTCATGTTGGTCATTTTCGTTTGGGATGGATTCAATATTTTAAGTCCCGTGATAATGATTTCAATGAATAAAAGTCTACGAAAGCAGGTGTTC
TRN  10010101100011000
NAM  SRG3_CAEEL/1-292
ASQ  MSYEH---------------CISGYTNFNENIHYFYQFAYLFTAICINYRILYVIWVSQR-.HFYRNQSFYNLYSVDCFTSVLAMSNELIFTRSFLYFPQLCVSFSEIVKNSPVFMRIYYCLLSYLIAIKPVIHIFIAVNRMSC-VMFPVTYSQNWSQKLRIMLIVIFLAPFLVIWNVLISDNFIGYVNGGF----GISYTRRVTWASLSLMQFTLIILTVLITMVTTTVTFYKMTTMKKRIKASERALCIAAALISVGFLLEAITQSFFAFFK-EAPWLLDVMNYLRFATMDILFVGSPLVLLLVSDQFRGHVL
NAM  SRG9_CAEEL/1-301
ASQ  MDTNSTTPMSI-----TDMECNPNYSYLVENIKYLLQAAYMVPPAFLYARILYVIWVKHR-.KVYSRHQFFVIYSMDSIVGFILLLLDIFITRFFVYVPQLCIPASKFFQSHSLLMNIYYPLLNYLHCAQPLIQIFLTLNRMSS-VIWPVDHNKVWSKNLSFIVAFVSLSPFLIIWNTIISPKIIIYYFGGF----FMLGLKAVEWADISLFLFLVRSVAVIITVASTVIMFLRMSKMKKRMKSSERTLCLACVIHSICFMVPSFFEALANFNEAYGSSWVNFLIQP--FAWDVLNVGSPLIMIFVSGQLRHHVL
DSQ  ATGGACACGAATTCAACAACTCCAATGTCTATT---------------ACTGATATGGAATGTAATCCTAACTATTCATATTTAGTAGAAAATATAAAATATCTGTTGCAAGCTGCATATATGGTACCTCCAGCTTTTCTGTATGCTAGAATTCTATATGTGATATGGGTCAAGCATAGA---...AAAGTTTATAGTCGGCATCAGTTTTTTGTGATTTATTCGATGGATAGTATAGTGGGCTTCATCCTCCTCCTCCTTGATATTTTCATCACTAGATTCTTTGTTTACGTACCCCAGTTATGTATCCCTGCTTCAAAATTCTTTCAATCCCATTCTTTACTTATGAATATCTACTACCCATTGTTGAACTATCTTCATTGTGCTCAGCCTCTAATTCAAATATTTCTAACTTTGAATCGAATGTCATCA---GTTATCTGGCCAGTTGACCACAACAAAGTTTGGTCTAAAAACCTTTCATTCATTGTTGCATTCGTCTCATTATCACCATTCCTAATAATTTGGAATACCATAATATCTCCAAAAATAATAATTTACTATTTCGGAGGATTT------------TTCATGCTTGGGTTGAAAGCAGTGGAGTGGGCTGATATCTCATTATTTTTATTTTTGGTTAGATCAGTTGCCGTTATAATTACTGTAGCTTCTACTGTAATCATGTTTCTAAGAATGTCGAAAATGAAAAAAAGAATGAAATCATCGGAAAGGACTCTTTGTTTGGCGTGTGTAATCCATTCAATTTGTTTTATGGTTCCGTCATTTTTTGAGGCTCTCGCAAATTTCAACGAAGCATACGGCAGTTCTTGGGTCAATTTTCTCATTCAACCA------TTTGCATGGGATGTTCTCAATGTTGGATCTCCGTTGATAATGATATTCGTCAGCGGTCAACTACGCCACCATGTATTG
TRN  10010101100011000
NAM  SRG8_CAEEL/1-296
ASQ  MSGNSSTPN-------QGINCDPSYSYVMENFKYFVQVAYLAPAVFLYSRILYVVWVQHK-.KSYGYHPFFMVY---SMVGLILVLLDIFITRLFVYVPQLCLPAAQFFISNPFLMELYYPLLNYLHCAQPFIQIFLTTNRMSS-VLWPVDHEKFWKINFSRILILNLIAPFFFIWNTIISKKVLIFYFGGF----YINYLKIIPWASMSLFLFIIRSAVVMITVVTTSITFWKMSHMKNRLKKSEGTLCKACAANSICFLVPAVFEAMKVLNTDWGKHWLAYLVQP--FAWDVLNVGSPLVMIFASGQLRTHAF
NAM  SRG7_CAEEL/1-300
ASQ  MASSPPIYN----LEQYGTNCSEEYSNFYENSKYWIQCLWLIPTLFLLVWIIITTRVRYP-.SQYSNLPYWILT-ADCVVSIILILLDLFVVRLFLYFPQLCSKFSTIFINYPIISDIYFPIYNYARVFKTGSQCGMILSRLFC-VLIPFGHDEKLRRHIPLFLTIICILPILVVWNTVISEKEVVFWYGGF----FVIYHRRVGWVSLSKLHLTFIFVSISFILISSLLLMRHLP--IESAVNAERRVITNSIFIIVAFFFQAAFQSFYAFFR-YTDWYPRFLVDFQFIIYDVMTVGYPLIFLNFAKEFRNHVF
NAM  SRG13_CAEEL/1-308
ASQ  MSTQFSLSSNISYDDPISFECDTSYDSGLELLKYIIQVTLLSINFILNFLIIRVTMFSKN-.NDFRENSFFIIYAADLIMGMYMSLSEILVGRLFIYVTLLCPILAPYFFTPSIFLKIFFTLSHYSQGFKTVSQVFLSFNRMTC-VVFPVGYSAIWKRILTPIIIVLFVLPIGIIWNVLISRVYANPSFGGF----SVNYIKLVSWASLSKLHLTYFIVSLILIIVISGVTLYALLILKHRIKSAEQTLTIATMVLSLEFSFLSVIQIYFAFFSSSTSEWRPFLLRVMYFTYDLLNFSTTIIFISCNPKLRKMLL
DSQ  ATGTCGACTCAATTCTCGCTTTCTTCCAATATTTCCTATGATGATCCAATTTCATTTGAATGTGATACAAGTTATGATTCAGGCTTGGAACTCTTGAAATATATTATTCAAGTGACCTTGTTATCAATCAATTTTATTTTAAACTTTCTGATAATTCGAGTTACAATGTTTTCCAAAAAT---...AACGATTTTCGGGAAAACTCTTTTTTCATTATTTATGCAGCTGATTTGATTATGGGAATGTACATGAGTTTGTCTGAAATCCTCGTTGGACGGTTATTCATTTATGTCACTTTGCTTTGCCCAATCTTGGCTCCATATTTTTTCACCCCGTCCATATTTCTTAAAATTTTCTTTACGCTGAGCCACTATTCCCAAGGTTTTAAAACCGTTTCTCAAGTATTTTTGAGTTTTAACAGAATGACATGT---GTAGTGTTTCCTGTTGGTTATAGTGCGATCTGGAAAAGAATTCTTACACCGATTATCATTGTGCTTTTTGTTTTACCTATTGGAATAATATGGAATGTTTTAATATCTCGAGTTTATGCAAATCCGTCTTTCGGAGGCTTC------------AGTGTTAACTACATAAAATTAGTATCATGGGCAAGCTTATCAAAATTACATCTGACATACTTTATAGTTTCCCTGATTTTAATTATAGTAATATCGGGTGTAACTCTCTATGCTCTTCTCATATTAAAACATCGGATCAAATCTGCTGAACAAACTTTGACTATTGCCACAATGGTTCTCTCACTTGAATTTTCATTTTTATCTGTGATACAGATTTACTTTGCGTTCTTCTCTTCGTCAACATCTGAATGGAGACCTTTCCTCCTACGAGTTATGTATTTTACCTATGATTTGTTGAATTTTTCTACAACTATTATATTTATATCATGTAATCCTAAGCTTCGAAAAATGTTGCTT
TRN  10010101100011000
NAM  SRG10_CAEEL/2-307
ASQ  NSSRVVFPANFSYEDPLPFECNEDPNVVLSLAMYGMQSSYLIVGAVLNVMIV-YTVFHGN-.-SYRDNSFYMLYCADAIVGIYINTAEVIFGRIFIYITPLCPIASPYFFTPSILTKMYYAALHYSLGFKTFSQIFMSFNRMTC-VIFLMKHLKLWKQILKPVLIITFILPLGVIWKILLSRVYINPNGAGF----SVNYKDYFPWANISILHLFHFTLCFVLVIIFFVATILGLTMLKQRIKSAERSLTIVTMIMAVQTVTFASIQIYFVFFAAYTPKIRSVLLQIVSFVFDSLYVFSPIALIVMSRQLRKDIF
DSQ  AACTCATCGCGGGTTGTGTTTCCTGCCAACTTCTCATACGAGGATCCACTTCCTTTCGAGTGTAATGAAGATCCAAATGTGGTATTATCGTTGGCAATGTATGGAATGCAATCAAGTTATCTGATTGTTGGAGCTGTCCTCAATGTCATGATTGTT---TATACTGTGTTCCACGGGAAT---...---TCATACAGGGACAACTCATTTTATATGTTGTATTGCGCCGACGCAATCGTGGGAATATACATAAACACTGCAGAAGTAATCTTTGGTCGTATCTTCATCTACATAACCCCACTCTGTCCAATTGCTAGCCCATACTTCTTCACTCCAAGTATTCTGACAAAAATGTACTATGCTGCATTGCATTATAGTTTGGGATTCAAGACATTTTCACAAATTTTCATGAGCTTCAATCGGATGACCTGT---GTTATTTTCCTAATGAAGCATTTGAAGCTATGGAAACAAATATTGAAGCCTGTCTTAATTATTACATTCATCCTCCCGCTTGGTGTGATCTGGAAAATTTTGTTATCCCGTGTGTACATCAACCCAAACGGAGCTGGATTT------------TCGGTGAACTACAAAGATTATTTCCCATGGGCGAATATTTCAATTCTTCATCTGTTCCACTTCACACTTTGCTTTGTACTAGTTATCATATTCTTTGTCGCAACAATTCTTGGTCTGACAATGCTGAAACAAAGAATTAAGAGTGCTGAAAGATCATTGACAATTGTTACGATGATTATGGCAGTGCAGACAGTGACTTTCGCATCTATTCAGATCTACTTTGTCTTTTTCGCGGCCTACACTCCAAAGATCCGAAGTGTCCTTCTACAAATTGTGTCATTTGTTTTTGATTCTCTTTATGTATTCAGTCCAATTGCATTAATTGTGATGAGTCGGCAACTTCGAAAAGATATCTTC
TRN  10010101100011000
NAM  P91535_CAEEL/1-309
ASQ  MSTRLIIPANFSYDDPLPFTCNQDSHVMLSILEYLVQATYLSVSAVLNSMIV-YTIFRCKGkHSYRRNPFFVLYAAEAVMNVYSCVIEVLFGRLIIYMTPLCPALSPFFFTPSILTKLYFLLNHYCLAFKTLSQIAISFNRMTC-VIFPVHHFKLWQNILAPVLVSLFVLPLGVTWNILVSRVYVNPNGAGF----SVNYRDAVAWANISFLHLFHCIPCLFLMIVFFLASIFGLTMLENRLRSAERSLIIFTMTLGVETMLFAIAQIYFAFLAGYLPGIRPLMLLISFNVFDVLYVYSPIALILMNRQLRRDIF
DSQ  ATGAGCACCCGTCTCATAATCCCCGCTAACTTTTCCTACGATGATCCTCTGCCATTCACTTGTAACCAAGATTCGCATGTGATGCTTTCCATATTGGAGTATTTGGTTCAGGCGACCTATCTATCTGTCAGTGCCGTATTGAATTCCATGATAGTT---TATACAATATTCAGGTGTAAGGGAaagCATTCGTATCGGCGGAACCCGTTTTTTGTGTTGTACGCCGCGGAGGCAGTAATGAACGTCTACTCCTGCGTCATAGAAGTCCTTTTCGGTCGTCTCATTATCTACATGACACCCCTCTGTCCGGCCCTGAGCCCTTTTTTCTTCACACCATCAATCCTTACCAAACTCTACTTCCTCCTAAACCATTACTGTCTGGCGTTCAAGACCCTGTCTCAAATCGCGATCAGCTTCAATCGAATGACCTGT---GTCATATTCCCGGTGCACCATTTCAAGCTCTGGCAGAATATTTTGGCTCCGGTGCTTGTCAGTCTTTTCGTACTTCCTCTAGGCGTCACCTGGAATATTTTGGTGTCCAGGGTGTATGTGAACCCGAATGGCGCGGGGTTT------------TCAGTCAATTACCGGGATGCGGTGGCATGGGCGAATATTTCATTTTTGCATCTTTTTCATTGCATCCCGTGTCTTTTCCTGATGATCGTGTTCTTTTTGGCGTCGATTTTTGGATTGACAATGCTGGAAAATCGGCTGAGGAGTGCTGAGAGGTCGCTGATCATTTTTACAATGACGCTTGGTGTGGAGACTATGCTGTTCGCTATTGCTCAGATCTATTTCGCATTCCTTGCTGGCTACCTACCTGGGATCCGTCCGTTGATGCTTCTCATCTCATTCAACGTGTTTGACGTTCTCTACGTCTACAGCCCGATCGCATTGATCCTGATGAATCGGCAGTTGCGAAGGGATATTTTC
TRN  10010101100011001
NAM  P91275_CAEEL/1-303
ASQ  MSDFSPDMKNLD-IDPIPVDCDLSYNTNIEVLKFTAQIIYIITGIFLNSAVLGTILWRCR-.EVYSTNSFFTLFSVDCIANISILITEGLFARFFIYFTPICPVLADYFQSPLVGFKIIMLLTHHVSICKSLLQVLLVLNRMTC-VLFPITHDSIWRKSLKYVISAVFLIPFCADWNIAISRVYMQSTYGGF----WVSYFKKVSWASQSRFQLVFIIIALSFTFICTAITLLKLP---ERSKEIEKAISNATVIISIGFTFKVLFQIYYSFFFSYTDASSPVYGFS-FLALDFLTVGSPIVMICVSRNLRTHIF
DSQ  ATGTCAGATTTCTCGCCTGACATGAAGAATCTTGAT---ATTGATCCAATTCCTGTAGACTGTGATTTATCCTATAATACAAACATTGAAGTTTTAAAATTCACAGCTCAAATAATTTACATTATTACTGGGATATTTTTGAATTCGGCCGTATTGGGGACTATTCTCTGGAGATGTAGA---...GAAGTTTATTCCACGAACTCTTTTTTTACTCTTTTTTCGGTTGATTGTATAGCTAACATATCAATTCTTATAACAGAAGGTTTATTTGCTCGTTTCTTTATTTACTTTACACCAATATGCCCTGTTCTCGCTGATTACTTTCAATCTCCGCTTGTTGGGTTTAAGATTATAATGTTATTAACTCATCATGTATCAATTTGTAAATCCCTTTTACAAGTTTTGTTAGTTTTAAATCGAATGACGTGT---GTCCTGTTTCCAATAACGCACGATTCAATATGGAGAAAAAGCTTGAAATATGTGATTAGTGCAGTTTTTTTAATTCCATTTTGTGCTGACTGGAATATTGCTATATCTCGAGTTTACATGCAATCCACGTATGGAGGTTTC------------TGGGTTAGCTATTTCAAGAAAGTTAGCTGGGCAAGCCAATCTCGTTTTCAACTTGTTTTTATTATTATTGCATTATCATTTACATTTATATGCACTGCAATTACTTTGTTAAAACTTCCA---------GAAAGATCAAAAGAAATAGAAAAAGCAATCTCTAATGCAACGGTTATCATATCCATTGGGTTCACTTTTAAAGTTTTATTTCAGATATACTACAGCTTTTTCTTCTCATACACTGATGCATCAAGCCCCGTTTATGGATTTAGC---TTTTTAGCTCTAGACTTTTTAACTGTTGGTTCTCCAATTGTAATGATATGTGTTAGCAGAAATCTTCGAACTCACATTTTT
TRN  10010101100011000
NAM  O45150_CAEEL/28-332
ASQ  HSSNQLLSD-FAFRSQAMLKCHPGFNTKLELLKYGIQFVYFIVGLGFHFAVI-KVLHKKW-.SVYSKYPFLKLYYVDSILSVLIILLDLVLIRVFNYIPPLCQWVLQEFPEPSQLISILF-IEQYLQFVKSLIFCFMVVNRANN-VICVKSFGTIQSCIIPHVIVFCILCPLLGVWTAFLSDSRFVPFQGGFIHETMMEYH----WITVSQFSVIISSITIVTVCICSVISMLCISRTHAENKHTEQSLTASALAMSIFYVFALSMNIYCQKAHASSLEMLEFWKALTAFAFDIILVCPPVIMLCLNVRLRINVF
//