EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02117 - Sra)
FAM  PF02117
PID  Sra
DES  C.elegans Sra family integral membrane protein
IPR  IPR000344
ANO  10
ALN  332
AID  0.405992
APH  (((((SRA9_CAEEL/1-330:0.43229,SRA8_CAEEL/1-328:0.39953):0.10122,(SRA6_CAEEL/1-328:0.29318,SRA2_CAEEL/1-328:0.42537):0.12137):0.03217,((SRA4_CAEEL/1-328:0.27806,SRA3_CAEEL/1-328:0.23125):0.04480,SRA7_CAEEL/1-328:0.26564):0.26088):0.28087,SRA1_CAEEL/1-328:0.49300):0.35291,SRA11_CAEEL/3-332:0.86916,SRA10_CAEEL/6-335:0.68724);
ATP  (((((SRA9_CAEEL/1-330,SRA8_CAEEL/1-328),(SRA6_CAEEL/1-328,SRA2_CAEEL/1-328)),((SRA4_CAEEL/1-328,SRA3_CAEEL/1-328),SRA7_CAEEL/1-328)),SRA1_CAEEL/1-328),SRA11_CAEEL/3-332,SRA10_CAEEL/6-335);
ATL  5.56894
DNO  10
DLN  996
DID  0.52004
DPH  (((((SRA7_CAEEL/1-328:0.22417,SRA4_CAEEL/1-328:0.25186):0.04152,SRA3_CAEEL/1-328:0.20940):0.16526,((SRA2_CAEEL/1-328:0.31396,SRA6_CAEEL/1-328:0.20452):0.09462,(SRA8_CAEEL/1-328:0.31505,SRA9_CAEEL/1-330:0.30958):0.05871):0.04823):0.14852,SRA1_CAEEL/1-328:0.37710):0.19873,SRA11_CAEEL/3-332:0.54427,SRA10_CAEEL/6-335:0.53326);
DTP  (((((SRA7_CAEEL/1-328,SRA4_CAEEL/1-328),SRA3_CAEEL/1-328),((SRA2_CAEEL/1-328,SRA6_CAEEL/1-328),(SRA8_CAEEL/1-328,SRA9_CAEEL/1-330))),SRA1_CAEEL/1-328),SRA11_CAEEL/3-332,SRA10_CAEEL/6-335);
DTL  4.03876
RID  0.405992
RPH  (((((SRA9_CAEEL/1-330:0.43229,SRA8_CAEEL/1-328:0.39953):0.10122,(SRA6_CAEEL/1-328:0.29318,SRA2_CAEEL/1-328:0.42537):0.12137):0.03217,((SRA4_CAEEL/1-328:0.27806,SRA3_CAEEL/1-328:0.23125):0.04480,SRA7_CAEEL/1-328:0.26564):0.26088):0.28087,SRA1_CAEEL/1-328:0.49300):0.35291,SRA11_CAEEL/3-332:0.86916,SRA10_CAEEL/6-335:0.68724);
RTP  (((((SRA9_CAEEL/1-330,SRA8_CAEEL/1-328),(SRA6_CAEEL/1-328,SRA2_CAEEL/1-328)),((SRA4_CAEEL/1-328,SRA3_CAEEL/1-328),SRA7_CAEEL/1-328)),SRA1_CAEEL/1-328),SRA11_CAEEL/3-332,SRA10_CAEEL/6-335);
RTL  5.56894
LNK  SRA10_CAEEL/6-335:Q20405:Z37092
LNK  SRA11_CAEEL/3-332:Q20411:Z37092
LNK  SRA1_CAEEL/1-328:Q09203:Z48009
LNK  SRA2_CAEEL/1-328:Q09204:Z48009
LNK  SRA3_CAEEL/1-328:Q09205:Z48009
LNK  SRA4_CAEEL/1-328:Q09206:Z48009
LNK  SRA6_CAEEL/1-328:Q09208:Z48009
LNK  SRA7_CAEEL/1-328:Q09209:Z48009
LNK  SRA8_CAEEL/1-328:Q09210:Z48009
LNK  SRA9_CAEEL/1-330:Q09212:Z48009
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SRA10_CAEEL/6-335
ASQ  ANSSKCATEDQMILQTSLLLRINVIIMTIVAIITFILTYKALFILKIRPIFHSSTKILLYTSLLFVNVHAVIFMVIQNTALIRSFTLSDKPCEIMRTTLECRFQNHVLIFGIAGVNFNQFGLTVDRLLATIIPQSYSHMGALPGVILSVLVVACSIAAPLIIAIGDPYDDIVPNCFFFPEHSAPRANIFLVTLSTLVITSIFLNFIIIYANKKLEKGCRTRFYVTQRYQKREALISTRIISYIAASQFLGLTLYSTMVLTLRLHK--SMIPISIYHNMVWWAYTVPFAAVSLPALLIYRINQVGSNRKRVINRITAKVETQEEHMKSLKELW
DSQ  GCCAACTCTTCAAAATGTGCAACAGAAGATCAAATGATACTCCAAACATCTCTATTACTACGAATTAATGTAATTATAATGACAATAGTGGCAATTATCACATTTATTCTTACCTACAAAGCATTGTTCATTCTCAAAATACGACCAATTTTTCACAGTTCTACCAAAATTTTACTCTATACTAGCTTGTTATTTGTAAATGTTCATGCGGTTATTTTCATGGTTATTCAGAATACTGCCTTAATCCGGAGCTTCACATTAAGCGATAAGCCATGCGAAATAATGAGGACAACTCTAGAGTGTCGATTTCAAAATCACGTGCTCATTTTTGGAATAGCGGGTGTCAACTTTAATCAATTCGGGTTGACTGTAGATAGACTTTTGGCGACAATAATTCCACAATCCTACTCACATATGGGTGCACTTCCAGGAGTTATTCTGTCAGTTCTTGTGGTCGCTTGCAGTATCGCAGCTCCTCTAATCATTGCAATTGGTGATCCATACGATGATATTGTGCCAAACTGTTTCTTTTTTCCCGAACATTCTGCTCCGCGAGCCAATATTTTCTTGGTCACATTGAGCACTCTAGTTATCACTAGTATATTCCTAAACTTCATCATCATATATGCAAACAAAAAGCTGGAGAAAGGTTGCAGAACTCGTTTCTATGTGACTCAAAGATATCAAAAACGAGAAGCACTCATCTCAACTCGTATCATCTCATATATTGCTGCGTCACAGTTTCTCGGATTGACACTTTACTCGACAATGGTGTTGACTTTGAGACTTCACAAA------TCAATGATTCCCATCTCTATTTATCATAATATGGTTTGGTGGGCTTATACTGTTCCATTCGCAGCGGTCTCCTTGCCAGCTTTACTTATATATCGTATCAATCAAGTGGGTTCAAATCGAAAACGAGTCATAAATCGGATAACTGCAAAGGTGGAAACTCAGGAGGAACATATGAAATCTTTAAAAGAATTGTGG
TRN  10010101100011000
NAM  SRA9_CAEEL/1-330
ASQ  MATIACASIIEQQRLRSSNFVIAQYIDLLCIVITFVTTYPAIQLVLNKSLFQWSTKMLILESLFFANLYQIFYGIEAITILYKHHFMTSDFCNIMQTESNCAPYLKVILGTTGGMIFAQTGLMIERTCATFLASYRKRKSEIIGFSITIIVFFCSSITGKLFIWDDPLDGMVLGCFILPKNSYKRYNTYFTVCTVLPLFNLGISILLKIYNTKLEY--SSRFEVSARFQKREVIDSTGTVCFLAFSLFILLFIYSVGVGALRHLLHENIISQEDFNLCVVWLYTIPFIAMLLPLLLIYRIRRTRSNRIEMLIEFTKQKQSQENHISQMKNMW
DSQ  ATGGCTACCATAGCTTGTGCATCAATCATAGAACAGCAAAGGTTGCGTAGTTCAAATTTTGTAATTGCTCAATACATTGATCTTCTTTGTATTGTTATCACTTTTGTGACCACCTATCCAGCAATTCAATTGGTTTTGAACAAGTCATTATTCCAATGGTCCACGAAAATGCTCATTCTAGAAAGTTTATTCTTTGCAAATTTGTATCAAATTTTTTATGGAATAGAAGCAATTACCATATTGTACAAACATCATTTCATGACAAGCGATTTCTGCAACATAATGCAGACAGAATCCAATTGTGCACCTTATTTAAAAGTTATTCTAGGTACAACAGGCGGTATGATTTTTGCGCAAACTGGATTAATGATTGAAAGAACTTGTGCAACATTTCTTGCAAGTTATAGAAAACGGAAAAGTGAAATTATTGGGTTTTCAATTACAATTATTGTGTTTTTCTGTAGTTCCATTACTGGAAAGCTTTTTATATGGGATGACCCCTTGGATGGGATGGTTCTTGGATGCTTCATTCTTCCCAAAAATAGCTATAAACGGTACAACACTTATTTTACTGTCTGTACAGTTTTACCCTTATTCAATTTGGGAATATCCATTCTTCTGAAAATTTATAACACGAAACTGGAATAT------TCAAGCCGCTTTGAAGTGAGCGCTCGTTTCCAAAAACGTGAAGTCATTGATTCCACTGGAACAGTTTGCTTTCTAGCATTTTCTTTATTTATTTTATTGTTTATCTATTCTGTTGGAGTAGGGGCATTGAGACATTTGTTACACGAAAATATAATTTCACAAGAAGACTTCAATTTGTGTGTTGTTTGGCTTTATACAATTCCATTCATTGCAATGCTACTTCCATTACTCTTAATATATCGTATCCGCCGAACTCGTTCAAACAGAATTGAGATGTTAATTGAATTTACAAAACAAAAGCAATCTCAGGAGAACCATATTAGCCAGATGAAGAACATGTGG
TRN  10010101100011000
NAM  SRA8_CAEEL/1-328
ASQ  MENLTCASSVEQDRFASLNFIISQSVDLITSFFTYMLSIIAIKMVLKQSIFETSTKILLFLNIFYANLYQIVYSIDVVVILYKHFFMQEEVCSLLILESSCAPFLETLIGTSSGMMYCQTGLLIERFCATFLKTYNGKKTIFVGSFIAIVVMISTTSTGKLVIWDDPLDDAVLACFIFPKKSKARSTIHFYISTVVSLFNLAASVALNKYNKTLEY--QVRFKICARFHKRQVIESTETICFLNFTQFVFMFIYSSGNSTLKSIR--DYIQPETYNFWVVWCYTVPFIALTFPLLLIYKVKSTRGIRAQKIVQISNTKQTQDEHINQMKVMW
DSQ  ATGGAAAACCTAACTTGCGCTTCGTCTGTTGAGCAGGATCGTTTTGCCAGCTTGAACTTTATAATTTCTCAATCGGTTGATCTAATAACATCATTTTTCACATATATGTTATCGATAATTGCTATCAAAATGGTTTTGAAACAATCAATATTCGAAACTTCAACTAAAATACTATTATTTTTAAATATCTTCTACGCGAATCTTTATCAAATTGTATATAGTATCGACGTAGTGGTCATTCTTTACAAGCACTTTTTCATGCAGGAGGAAGTGTGTAGTTTATTGATATTAGAATCAAGTTGTGCTCCATTTTTGGAGACATTAATTGGTACTTCAAGTGGTATGATGTATTGTCAAACTGGATTATTGATTGAAAGATTCTGTGCTACATTTTTAAAAACCTATAATGGTAAGAAAACCATTTTTGTTGGAAGTTTTATTGCAATAGTTGTAATGATCTCTACCACATCAACTGGGAAACTTGTAATTTGGGATGACCCATTAGACGATGCAGTTCTGGCGTGTTTTATATTTCCAAAGAAGAGTAAAGCAAGATCTACCATACACTTTTACATAAGTACTGTTGTTTCGTTGTTTAATTTGGCAGCTTCTGTAGCATTGAACAAATACAACAAAACGTTGGAATAT------CAAGTTCGGTTCAAAATCTGCGCCCGATTTCATAAACGTCAAGTCATAGAGTCAACGGAGACAATTTGCTTTCTAAATTTCACTCAATTTGTATTCATGTTTATTTATTCATCTGGTAATTCTACATTGAAATCAATTCGT------GATTACATCCAACCAGAGACATACAATTTTTGGGTCGTCTGGTGTTATACTGTCCCATTTATCGCATTAACATTTCCACTACTTTTGATCTACAAAGTGAAGTCAACGCGTGGCATTCGAGCTCAGAAGATTGTACAGATTTCGAATACTAAGCAGACGCAAGATGAGCACATAAATCAGATGAAAGTTATGTGG
TRN  10010101100011000
NAM  SRA7_CAEEL/1-328
ASQ  MSAPNCARKYDIARLSSLNFQISQYVYLSLISLTFIFSYFAVKIVHQKSIFQLSTKILLFHNLVSANLHQLLYLFSALRRLNLAYFYIDEPCVPLISEADCLPYLKVLVTGISGMIYGQTGLLLERGCATFIKDYDKKTSMFVGIAISIAILFLSLITGKIIIWDDPLQGYLLSCVSYPSQSVERSRLFASIYTFISSFNLVFSVLLRRYNKKLEY--STPFVVGPRFRKREVIDSTSTICFLTFVQFIFMFIYSFGIFTLKTIR--SMLTYRQYYFIVVWFYTIPFIAALFPILLVYRIRSSHVSRVTIIKTFTKTKQTQEEHIKQLKNVW
DSQ  ATGTCTGCACCGAACTGCGCACGAAAATATGATATTGCTCGTCTTTCCAGCTTGAATTTTCAAATTTCCCAATATGTTTATCTTAGCTTGATAAGCTTAACTTTTATATTTTCTTATTTTGCTGTGAAAATTGTTCATCAAAAATCGATTTTCCAACTTTCCACTAAAATCTTATTATTTCACAATTTGGTTTCTGCGAATCTTCATCAACTTTTATACTTATTTTCCGCACTCCGAAGGCTCAACCTGGCATATTTCTATATTGACGAACCATGTGTTCCTCTAATATCGGAAGCTGACTGTCTACCTTACCTCAAGGTTTTAGTAACTGGAATAAGTGGAATGATCTATGGCCAAACTGGTCTACTTTTGGAACGAGGTTGTGCAACTTTCATCAAAGATTATGATAAGAAGACAAGCATGTTTGTTGGGATAGCAATATCAATTGCCATTTTGTTTTTGAGCTTGATCACTGGAAAAATTATAATTTGGGATGACCCACTTCAAGGATATCTTCTTTCGTGTGTTTCCTATCCAAGTCAAAGTGTTGAAAGATCAAGACTATTTGCAAGTATTTATACATTTATATCTTCATTCAATTTGGTTTTCTCAGTTTTGTTAAGAAGATATAACAAAAAACTGGAATAT------TCAACACCCTTTGTTGTTGGCCCGAGATTTCGGAAAAGAGAAGTGATTGACTCCACAAGTACAATATGCTTTTTGACATTTGTTCAATTCATATTCATGTTCATTTATTCATTCGGAATATTCACACTGAAAACTATTCGA------AGCATGCTTACTTACAGACAGTACTATTTCATTGTTGTCTGGTTCTATACAATTCCATTCATTGCTGCGCTGTTTCCAATTCTACTAGTTTACAGGATTCGTTCTTCACATGTTAGCCGAGTAACGATTATTAAAACATTTACAAAAACCAAGCAAACACAAGAAGAACACATTAAGCAATTGAAAAACGTTTGG
TRN  10010101100011000
NAM  SRA4_CAEEL/1-328
ASQ  MSLTKCASKLEIDRLISLNFRINQIIVLIPVFITFIFTYYAIKVVQKKSIFELSTKFLLIQNFFSANLHQVLYAIETIRRLHISLFETNQPCIPLKTEFECRLYLEVFVSGVAGMVYGQTGLLLERACATFIKNYEEKKSVRTGLAISVSVLCLSFITSRLIIWDDPLDGYQLTCISFPSDSVDRSSYFQSICTLLALFNLVTSILIWKYNKKFEY--STPFVVGPRFRKREVIDSTSTICFLTFVQFIFFLVYSLGFFIIKSIR--EIISYENYYLVAVWLYTPPYIAASFPILIFYRIRSSYANRVLIIKKFTNTKQTIEEHIQQMKNAW
DSQ  ATGTCCTTGACGAAGTGTGCTTCAAAACTTGAAATTGATCGGTTGATTAGTTTGAACTTCCGAATCAATCAAATAATAGTTTTGATTCCCGTATTCATTACTTTCATTTTTACCTACTATGCTATTAAAGTCGTCCAGAAAAAGTCGATATTTGAACTTTCGACAAAGTTCTTATTAATTCAAAACTTTTTTTCTGCAAATTTACATCAAGTTCTCTACGCAATCGAAACAATTCGAAGATTACACATATCGCTTTTTGAAACGAATCAACCCTGCATTCCCTTGAAGACAGAATTCGAATGTCGATTATATTTGGAAGTATTTGTTTCTGGAGTTGCTGGAATGGTATACGGACAGACAGGATTACTTTTGGAACGAGCTTGTGCAACTTTCATAAAGAACTATGAGGAAAAAAAGAGCGTTCGTACGGGGCTCGCTATATCTGTATCGGTATTGTGTTTGAGCTTCATAACCTCGAGATTAATTATCTGGGATGATCCTTTGGATGGTTATCAACTCACTTGTATTTCATTCCCAAGTGATAGTGTCGATAGATCATCTTATTTTCAAAGTATTTGTACTCTACTAGCTTTATTCAATTTAGTAACTTCTATTCTGATATGGAAGTACAATAAGAAATTTGAATAC------TCAACTCCATTTGTCGTTGGCCCAAGATTCCGTAAACGTGAAGTAATCGATTCAACTAGTACAATCTGCTTCCTTACTTTTGTTCAATTCATATTTTTCTTGGTATATTCGTTAGGATTTTTTATCATAAAATCTATTCGA------GAAATTATCTCATATGAGAATTACTACTTAGTTGCAGTTTGGCTTTATACTCCTCCGTACATTGCTGCATCTTTTCCAATTCTAATTTTCTATCGGATTCGGTCATCGTATGCCAACCGCGTACTCATCATTAAAAAATTTACAAACACCAAGCAAACTATAGAGGAACATATTCAACAAATGAAAAACGCTTGG
TRN  10010101100011000
NAM  SRA3_CAEEL/1-328
ASQ  MSSQKCASHLEIARLESLNFKISQLIYFVLIITTLFFTFFALKVIQKKCIFQLSTKILLYQNLFSANIHQIFLGITIVERLNIAFFKLNDKCIPLRPETNCQLYLEMFIAGLSGMVYGQTGLLFERACATFIKKYEKRKSLATGIITSIIVLLLSGSTARIIIWDDPLSEYQLACTSWPSKSRDRSTMFFSICTFISLFNLVISLLIRRHNEKLEY--STPFVVGPRFRKREVIDSTSTICFLTFFQFIFMFIYSFGVFLLGTIR--EIIGYEQYYFWVVWVYTIPFIAASFPILLIYRIRYSNTNRIMIIKQFTSTKQTQEDHIKQMKNVW
DSQ  ATGTCGTCTCAAAAATGTGCTTCTCACCTTGAAATTGCTCGACTTGAAAGTTTGAATTTTAAAATTTCTCAATTAATTTATTTTGTTCTAATAATTACAACGTTATTCTTCACATTTTTCGCGTTGAAAGTCATACAAAAGAAGTGCATCTTTCAATTGTCTACTAAAATTCTACTCTATCAAAACCTATTCTCCGCAAACATCCATCAAATATTTCTCGGCATCACTATTGTTGAACGACTGAACATTGCATTTTTCAAGCTTAACGATAAGTGTATTCCACTAAGACCGGAAACGAATTGTCAGCTATATCTTGAAATGTTTATTGCTGGTTTAAGTGGAATGGTATATGGACAAACTGGTTTGCTTTTTGAGCGAGCATGTGCTACTTTCATAAAGAAATACGAGAAAAGGAAAAGCTTAGCAACTGGCATCATCACTTCTATTATTGTATTGCTATTAAGTGGAAGCACTGCTCGAATAATTATTTGGGATGATCCATTGTCTGAATATCAACTTGCATGTACTTCATGGCCAAGTAAAAGCCGCGACAGATCCACTATGTTCTTCAGTATTTGCACTTTTATTTCCTTGTTCAATTTGGTCATTTCTCTTCTGATTCGAAGACATAATGAAAAACTAGAATAT------TCAACCCCATTCGTCGTAGGTCCAAGATTTCGGAAACGAGAAGTAATTGACTCAACTAGTACAATCTGCTTTTTGACGTTTTTCCAATTCATCTTTATGTTTATCTATTCATTCGGTGTGTTCCTCCTTGGAACTATCAGG------GAAATTATTGGCTATGAGCAGTATTATTTCTGGGTCGTTTGGGTTTATACAATCCCATTCATTGCTGCATCCTTTCCAATTCTTCTGATCTATAGAATTCGATATTCTAATACAAATCGAATAATGATAATCAAACAGTTTACAAGTACAAAGCAGACACAAGAGGACCATATCAAACAAATGAAAAATGTTTGG
TRN  10010101100011000
NAM  SRA6_CAEEL/1-328
ASQ  MSNLSCAAPDVLERLDSFNMKLSQFVDLLAIILAFFASYFAIKIVINQSFFELSTKILLLQNLFYTNLYQISYGIEAIGMLYRGFFMLSEPCSILQSETSCAPYFKVLMIGTSGMIFGQTGLLIERAFATFATTYKTKKSVYIGVCISLIVLVCSTSSGFIILWDDPLEGWTIGCFAVSKSVVPRFNLFSILSTVLTLFNLIVSIFIQRYNKRFEF--ETRFKVGARFQKQELIESTGAICFLALSQFLWMFMYSFGILILRIIR--EDILPSTFYFWIAWCYTMPFIALMFPVLLIYRIRKTRARRTEKMKGITTEKQTQDDHIKQINAMW
DSQ  ATGTCTAATTTAAGTTGTGCTGCTCCAGATGTTCTCGAGCGATTGGATAGTTTCAACATGAAACTTTCCCAATTTGTGGATCTTTTAGCTATAATTCTAGCGTTTTTCGCTTCATATTTTGCCATCAAAATAGTAATTAATCAATCATTTTTCGAATTATCCACAAAAATTCTTCTACTCCAAAATTTATTCTACACAAATCTCTATCAAATCTCATATGGAATCGAGGCAATTGGGATGCTCTACAGAGGATTCTTTATGCTCAGTGAGCCATGCAGTATATTACAGTCTGAGACTTCATGTGCGCCGTATTTCAAAGTTCTAATGATTGGAACAAGTGGAATGATTTTTGGACAAACTGGTTTACTTATTGAGAGAGCGTTTGCAACATTTGCAACAACTTATAAGACTAAAAAGAGTGTTTATATAGGGGTATGTATATCATTAATAGTTCTAGTATGCAGTACTTCATCTGGATTTATCATTCTTTGGGATGATCCGCTGGAAGGATGGACTATTGGATGTTTTGCAGTTTCTAAGAGTGTTGTTCCCCGATTCAACTTATTTTCCATATTATCCACTGTATTAACACTTTTCAATTTAATTGTTTCAATTTTTATTCAGAGATATAACAAGCGATTCGAATTT------GAAACACGCTTCAAAGTTGGAGCTCGATTCCAGAAACAAGAACTCATCGAATCAACCGGAGCAATTTGCTTTCTGGCTCTTTCTCAATTTTTATGGATGTTCATGTACTCGTTTGGAATTCTGATACTGCGAATTATCAGG------GAAGATATTCTGCCAAGTACATTTTATTTTTGGATTGCCTGGTGCTACACAATGCCATTTATTGCCCTCATGTTCCCCGTTCTCTTGATCTACCGAATTCGCAAAACCCGCGCTCGGCGGACAGAGAAAATGAAAGGGATAACTACTGAAAAGCAGACTCAAGATGACCATATCAAACAGATAAATGCTATGTGG
TRN  10010101100011000
NAM  SRA2_CAEEL/1-328
ASQ  MSNSSCADEDLIIRFDSLNQKAAQFVYLLAIILTFITTYFAVKILFTQSFFEISTKILLVQNLFYANLYQFFHGIEAVRMLYKSFFMINDPCNFMEPEIECVFYYKIILMGSSGMVYGQTGLLIERLCATFSKDYKKKQSAIKCAVISILVLICSSSTGRLIVWDDPIDKYNFACYIPPKESYIRANHYFTMCAVLSTINFCISTFILKYNKRCEY--QTRFKVGARFQKQELIESTKAICFLTVSQFVAVFLNSFGMIVLVYIQ--ESISHRIFNLLVVWLYAFPIVVLMFPVILVHQIRSSRWRRALKIKVIKNEKQTQDDHMKHMKNMW
DSQ  ATGTCTAATTCAAGTTGTGCCGATGAAGATCTTATTATAAGATTTGATAGTCTCAATCAAAAAGCAGCTCAGTTTGTCTATCTTTTGGCTATTATTCTTACATTTATTACAACATACTTTGCCGTGAAAATACTTTTCACTCAATCATTTTTCGAAATATCTACCAAAATCCTGTTGGTCCAAAACTTATTCTACGCTAATCTGTATCAATTTTTCCATGGAATCGAAGCCGTCCGTATGCTATACAAAAGCTTTTTTATGATTAATGATCCCTGCAATTTTATGGAACCTGAAATTGAATGTGTGTTTTATTACAAAATAATTTTAATGGGTTCAAGTGGAATGGTCTACGGACAAACTGGTTTACTCATCGAAAGACTTTGTGCTACTTTTTCGAAAGATTACAAGAAAAAACAAAGTGCAATTAAATGTGCTGTTATTTCAATACTTGTTCTGATATGTAGTTCTTCAACAGGAAGACTGATTGTATGGGATGATCCCATTGATAAATATAATTTTGCATGCTATATTCCACCAAAAGAAAGTTATATTAGGGCAAATCATTATTTTACAATGTGTGCTGTCCTGTCGACTATTAACTTTTGTATTTCTACATTTATTTTGAAATACAATAAACGATGCGAGTAC------CAAACTCGTTTCAAAGTTGGTGCTCGTTTTCAAAAGCAAGAACTGATAGAATCAACAAAAGCCATTTGTTTCTTAACGGTTTCTCAATTTGTGGCAGTTTTTCTTAATTCATTCGGAATGATTGTTCTCGTATATATACAG------GAAAGTATTTCTCATCGAATATTCAATTTGTTGGTTGTATGGCTTTATGCGTTTCCTATTGTTGTTTTGATGTTTCCTGTTATATTAGTTCATCAAATTCGTAGCAGTCGATGGCGCAGAGCTTTAAAAATTAAAGTTATAAAGAATGAGAAGCAGACGCAGGATGATCATATGAAGCATATGAAGAATATGTGG
TRN  10010101100011000
NAM  SRA1_CAEEL/1-328
ASQ  MSNITSASAAQIDHASSWNFRFAVFCSQLSIISTFILSVIAVKWIFTKSTFQTSTKIILVFNFVYANIHQFMYAIISLGMAYKGIFLLDETCEWLITEKDCLLYTEVLYVGISGMIYSQTGILIERAFATLYRNYTAKISRLVGIIISTFVLIMSIATYQIIISDDPLEGVVLSCFVPAQHSAQRANTFLFIALILTFVNLISSAAVMFYNKRLEY--SIRYKVRERFKKREAIYSTHTICVVCMAQFVTMLVYSSGVLILRCNM--SNILLTTFYKLITWVYTVQYNALLFPLILIFRIRATKLSRTKKIQDITSANQSQTEHYNQITSAW
DSQ  ATGTCCAACATAACCAGCGCATCTGCAGCTCAAATAGATCATGCGTCTAGTTGGAATTTCCGTTTCGCAGTGTTTTGCTCTCAATTGTCTATAATTTCTACTTTCATTCTATCAGTTATAGCTGTAAAGTGGATATTTACAAAGTCCACATTTCAGACATCAACTAAAATTATCCTAGTTTTTAACTTTGTCTATGCAAACATACACCAATTTATGTATGCAATTATATCACTGGGCATGGCTTACAAAGGAATATTTTTGCTTGATGAAACATGTGAATGGCTGATAACTGAGAAGGATTGCCTTCTATACACGGAAGTTCTATACGTTGGAATTAGTGGAATGATTTACTCACAGACTGGAATTTTAATTGAGAGAGCATTTGCTACCTTATACAGGAACTACACAGCAAAAATAAGTCGATTAGTTGGTATAATCATCTCAACTTTTGTGCTCATAATGAGTATTGCCACGTATCAAATTATAATCAGTGACGATCCTCTTGAAGGAGTAGTACTTTCATGTTTTGTCCCGGCTCAACATAGTGCTCAACGAGCCAACACATTTCTATTTATTGCATTGATTTTGACCTTTGTAAATTTAATTTCGTCAGCAGCCGTGATGTTTTATAACAAAAGATTGGAGTAT------AGCATTCGGTATAAGGTCCGCGAAAGATTCAAGAAGCGTGAAGCAATTTATTCAACTCACACTATTTGCGTAGTATGCATGGCTCAATTTGTAACAATGCTCGTGTACTCATCAGGAGTTCTTATACTTCGATGCAACATG------AGCAATATATTGCTTACTACATTTTATAAATTAATTACTTGGGTTTATACAGTTCAATATAACGCTCTTCTATTTCCTCTTATTCTGATTTTCCGGATTCGTGCGACAAAATTGTCCAGAACAAAGAAAATTCAGGACATCACTAGTGCTAATCAATCTCAAACGGAACATTACAACCAGATTACTTCGGCGTGG
TRN  10010101100011000
NAM  SRA11_CAEEL/3-332
ASQ  TNNPVCASDAHMEMYSSKLYTSALFLNLIIATTSMILTGFAIQKLFMESIINISTRMFLFCGLMCCSLHQTAYIVLRIQVIYQVFFKLSEPCNLYYPAIDCKYVTFSLVAGNTGMIFIQSAMTIDRIFATIFPKLWPKLKYWPGVVLSILMIACNYANVQIIFWGDPLTEYVPTCGQFPSKSVNRFQTFLAIALYMSIAHMVINVIILYINVLQDRQQSKSFNVNQRYQSREALKSSQAIFFLSMSQFFACLIYSVFTKVFLEFQ--LNLSPLQSGLVLALSYTTPYACIAIPSLIIFTFRFIKNQRLRNINELRSQTETGDECMRKIAKIW
DSQ  ACAAATAATCCAGTCTGTGCATCAGATGCACACATGGAAATGTACTCCTCAAAACTCTACACATCTGCACTTTTCCTCAATCTAATAATAGCGACTACTTCGATGATTTTAACAGGATTTGCTATTCAAAAGTTATTTATGGAGTCAATTATTAATATTTCAACTAGAATGTTCTTATTTTGTGGGCTCATGTGTTGCTCATTGCACCAAACTGCGTATATAGTTTTGAGGATTCAAGTGATCTATCAAGTTTTTTTTAAGCTCAGTGAGCCATGTAATCTTTACTATCCAGCGATTGACTGCAAGTATGTCACTTTTAGTCTTGTCGCTGGAAACACTGGAATGATTTTTATACAATCCGCAATGACTATTGATCGAATTTTTGCAACGATTTTCCCGAAGCTATGGCCGAAGTTGAAGTACTGGCCGGGAGTAGTTTTGTCAATATTGATGATCGCATGCAATTACGCTAACGTACAAATCATATTCTGGGGAGATCCACTGACGGAATACGTGCCAACTTGTGGACAATTCCCATCGAAATCTGTTAACAGATTCCAAACATTTCTAGCCATTGCACTTTATATGTCAATTGCTCATATGGTAATAAATGTAATTATTCTTTACATTAATGTTCTACAGGATCGACAGCAGAGTAAATCGTTTAACGTTAATCAGAGATATCAGTCTAGAGAAGCATTGAAATCTTCACAAGCGATTTTCTTCCTTTCAATGTCGCAGTTTTTTGCATGCCTGATATATTCGGTCTTTACAAAAGTGTTTCTGGAATTTCAG------CTCAATCTTTCCCCGTTACAATCTGGTCTGGTCTTGGCACTGAGCTATACAACACCATACGCTTGCATTGCAATTCCATCGCTTATAATCTTTACTTTCCGATTCATAAAAAATCAACGATTACGGAATATAAACGAACTGAGATCACAAACTGAAACCGGCGACGAGTGTATGAGAAAGATTGCCAAGATTTGG
TRN  10010101100011000
//