EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02108 - FliH)
FAM  PF02108
PID  FliH
DES  Flagellar assembly protein FliH
IPR  IPR000563
ANO  2
ALN  258
AID  0.263158
APH  (Q9Z6G6_VIBPA/1-257:1.30317,FLIH_ECOLI/1-220:0.55718);
ATP  (Q9Z6G6_VIBPA/1-257,FLIH_ECOLI/1-220);
ATL  1.86035
DNO  2
DLN  774
DID  0.429224
DPH  (Q9Z6G6_VIBPA/1-257:0.22714,FLIH_ECOLI/1-220:0.85150);
DTP  (Q9Z6G6_VIBPA/1-257,FLIH_ECOLI/1-220);
DTL  1.07863
RID  0.263158
RPH  (Q9Z6G6_VIBPA/1-257:1.30317,FLIH_ECOLI/1-220:0.55718);
RTP  (Q9Z6G6_VIBPA/1-257,FLIH_ECOLI/1-220);
RTL  1.86035
LNK  FLIH_ECOLI/1-220:P31068:D90834
LNK  Q9Z6G6_VIBPA/1-257:Q9Z6G6:AF069392
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9Z6G6_VIBPA/1-257
ASQ  MAGDRKRGFIRPDEDDALIEPQRWGLPDYGDSKEKKAKQTAFNYDPSWVPNFDEPEEEQALELTEEQIELIKQGAYQEGLYQGQEAGFKQGYDKGKEEGLQAGHAEGIELGKAEGVSAGQEFIQQQVEVFMN-LANQFAQPLELMNAQVEKQLVDMVLCLVKEVVHVEVQTNPQIILDTVKQSVEALPISGHPITLHLNPEDVAIIRSAYGEEDLDCRNWTLVSEPSLNRGDVQIEAGESSINYRMEERIKSVLHSFC
DSQ  ATGGCTGGCGATAGAAAACGTGGATTTATCCGTCCTGATGAAGATGATGCGCTGATTGAACCGCAACGTTGGGGTTTACCCGACTATGGCGATTCAAAGGAAAAAAAAGCCAAACAGACTGCGTTTAACTACGATCCTAGCTGGGTGCCAAACTTTGACGAGCCAGAAGAAGAGCAAGCTCTTGAACTGACAGAAGAACAGATCGAACTGATCAAGCAAGGCGCTTATCAAGAAGGTTTGTACCAAGGTCAAGAAGCTGGCTTTAAGCAAGGGTACGACAAAGGCAAAGAAGAAGGCTTGCAAGCAGGCCATGCTGAGGGCATAGAGCTGGGTAAAGCAGAAGGCGTTTCTGCTGGCCAAGAGTTTATTCAACAGCAGGTTGAAGTGTTTATGAAT---CTCGCCAACCAGTTTGCTCAACCTTTGGAGCTGATGAATGCTCAGGTAGAGAAGCAACTGGTGGACATGGTGCTGTGCTTAGTCAAAGAAGTGGTGCATGTCGAGGTTCAAACCAATCCACAAATTATTCTCGATACGGTTAAGCAGTCGGTAGAAGCGCTGCCGATTTCTGGCCATCCAATCACATTGCATCTCAACCCTGAAGATGTTGCCATCATTCGCTCTGCGTATGGTGAAGAAGATTTAGATTGCCGTAACTGGACACTGGTTTCTGAGCCATCACTTAATCGTGGCGATGTGCAAATCGAAGCAGGCGAATCGAGCATTAACTACCGCATGGAAGAGCGCATCAAGAGTGTGCTGCACAGCTTTTGT
TRN  10010101100011000
NAM  FLIH_ECOLI/1-220
ASQ  MSDNLPWKTWTP---DDLAPPQAEFVP----IVEPEETIIEEA-EP-----------SLEQQLAQLQMQAHEQG-YQAGIAEGRQQGHKQGY--------QEGLAQGLEQGLAEAKSQ-----QAPIHARMQQLVSEFQTTLDALDSVIASRLMQMALEAARQVIGQTPTVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVDDMLG-ATLSLHGWRLRGDPTLHPGGCKVSADEG----DLDASVATRWQELC
DSQ  ATGTCTGATAATCTGCCGTGGAAAACCTGGACGCCG---------GACGATCTCGCGCCACCACAGGCAGAGTTTGTGCCC------------ATAGTCGAGCCGGAAGAAACCATCATTGAAGAGGCT---GAACCC---------------------------------AGCCTTGAGCAGCAACTGGCGCAACTGCAAATGCAGGCCCATGAGCAAGGT---TATCAGGCGGGTATTGCCGAAGGTCGCCAGCAAGGTCATAAGCAGGGCTAT------------------------CAGGAAGGACTGGCCCAGGGGCTGGAGCAAGGTCTGGCAGAGGCGAAGTCTCAA---------------CAAGCGCCAATTCATGCCCGGATGCAGCAACTGGTCAGCGAATTTCAAACTACCCTTGATGCACTTGATAGTGTGATAGCGTCGCGCCTGATGCAGATGGCGCTGGAGGCGGCACGTCAGGTCATCGGTCAGACGCCAACGGTGGATAACTCGGCACTGATCAAACAGATCCAACAGTTGTTGCAGCAAGAACCGTTATTCAGCGGTAAACCACAGCTGCGCGTGCACCCGGATGATCTGCAACGTGTGGATGATATGCTCGGC---GCTACCTTAAGTTTGCATGGCTGGCGCTTGCGGGGCGATCCCACCCTCCATCCTGGCGGCTGTAAAGTCTCCGCCGATGAAGGC------------GATCTCGACGCCAGTGTCGCCACTCGCTGGCAAGAACTCTGC
TRN  10010101100011010
//