EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02090 - SPAM)
FAM  PF02090
PID  SPAM
DES  Salmonella surface presentation of antigen gene type M protein
IPR  IPR002954
ANO  4
ALN  147
AID  0.9216
APH  ((Q54058_9ENTR/1-147:0.02712,Q54049_9ENTR/1-147:0.04030):0.00000,Q54043_SALTI/1-147:0.04444,Q57351_9ENTR/1-147:0.07773);
ATP  ((Q54058_9ENTR/1-147,Q54049_9ENTR/1-147),Q54043_SALTI/1-147,Q57351_9ENTR/1-147);
ATL  0.18959
DNO  4
DLN  441
DID  0.930083
DPH  ((Q54058_9ENTR/1-147:0.03258,Q57351_9ENTR/1-147:0.04560):0.01535,Q54049_9ENTR/1-147:0.02189,Q54043_SALTI/1-147:0.03333);
DTP  ((Q54058_9ENTR/1-147,Q57351_9ENTR/1-147),Q54049_9ENTR/1-147,Q54043_SALTI/1-147);
DTL  0.14875
RID  0.9216
RPH  ((Q54058_9ENTR/1-147:0.02712,Q54049_9ENTR/1-147:0.04030):0.00000,Q54043_SALTI/1-147:0.04444,Q57351_9ENTR/1-147:0.07773);
RTP  ((Q54058_9ENTR/1-147,Q54049_9ENTR/1-147),Q54043_SALTI/1-147,Q57351_9ENTR/1-147);
RTL  0.18959
LNK  Q54043_SALTI/1-147:Q54043:AL627276
LNK  Q54049_9ENTR/1-147:Q54049:U43304
LNK  Q54058_9ENTR/1-147:Q54058:U43309
LNK  Q57351_9ENTR/1-147:Q57351:U43313
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q57351_9ENTR/1-147
ASQ  MHSLTRIKVLQRRCTVFHSQCESVLLRYQDEDRMLHAEEEAIVEQIAGLKLLLDTLRAENRQLSREEIYSLLRRQSIVRRQIRDLQLQITQIQEKRCELEKKTQEFQEKSKYWLRKEGNYQRWIVRQKRFYIQREIQQEEAESEEII
DSQ  ATGCATTCGCTGACCAGGATTAAAGTGCTACAGCGGCGCTGTACGGTATTTCATTCACAGTGTGAGTCGGTATTACTTCGCTATCAGGATGAGGACCGTATGCTGCACGCTGAGGAGGAGGCGATCGTTGAACAAATAGCGGGTCTGAAATTGCTATTAGATACGCTGCGTGCAGAAAATAGACAGCTCAGTCGTGAGGAAATTTATTCGTTATTACGTAGGCAATCTATTGTCCGCCGGCAGATAAGAGATTTACAACTTCAGATTACACAAATTCAGGAAAAACGATGCGAACTGGAAAAGAAAACTCAAGAGTTTCAGGAAAAAAGTAAATATTGGTTGCGCAAAGAAGGTAATTATCAACGTTGGATAGTTCGTCAGAAAAGATTCTATATTCAGCGAGAGATACAGCAGGAAGAGGCCGAGTCAGAGGAGATAATT
TRN  10010101100011000
NAM  Q54058_9ENTR/1-147
ASQ  MHSLSRIKVLQRRCTVFHSQCESILLRYQDEDRRLQDEEEAIGEQIAGLKLLLDTLRAENRQLSREEIYSLLRKQSIVRRQIKDLELQITQIQEKRYELEKKREEFQEKSKYWLRKEGNYQRWIIRQKRLYIQREIQQEEAESEEII
DSQ  ATGCATTCGCTGTCCAGGATTAAAGTGCTGCAGCGGCGCTGCACGGTATTTCATTCACAGTGTGAGTCGATCTTACTTCGCTATCAGGATGAGGACCGTAGGCTGCAGGATGAAGAGGAGGCGATCGGTGAACAAATCGCGGGTTTGAAATTGCTATTAGATACGCTGCGTGCAGAAAACAGACAACTGAGTCGTGAGGAAATTTATTCGTTATTACGTAAGCAGTCTATTGTGCGCCGGCAGATAAAAGATCTAGAGCTTCAGATTACACAAATTCAGGAAAAACGGTACGAACTGGAAAAGAAAAGGGAAGAGTTTCAGGAAAAAAGTAAATATTGGTTGCGCAAAGAAGGGAACTATCAACGTTGGATAATCCGTCAGAAAAGACTCTATATTCAGCGAGAGATACAGCAGGAAGAGGCCGAGTCAGAGGAGATAATT
TRN  10010101100011000
NAM  Q54043_SALTI/1-147
ASQ  MHSLTRIKVLQRRCTVFHSQCESILLRYQDEDRGLQAEEEAILEQIAGLKLLLDTLRAENRQLSREEIYTLLRKQSIVRRQIKDLELQIIQIQEKRSELEKKREEFQKKSKYWLRKEGNYQRWIIRQKRHYIQREIQQEEAESEEII
DSQ  ATGCATTCGCTGACCAGAATTAAAGTTTTACAGCGGCGCTGTACGGTATTTCATTCACAGTGTGAGTCAATATTACTTCGCTATCAGGATGAGGACCGCGGGCTGCAGGCCGAGGAGGAGGCGATCCTTGAACAAATAGCGGGTCTGAAATTGTTATTAGATACGCTGCGTGCAGAAAACAGACAGCTCAGTCGTGAGGAAATTTATACGTTATTACGTAAGCAGTCTATTGTTCGCCGGCAGATAAAAGATTTAGAACTCCAGATTATACAAATTCAGGAAAAACGGAGCGAGCTGGAAAAGAAAAGGGAAGAGTTTCAGAAAAAAAGTAAATATTGGTTGCGCAAAGAAGGGAACTATCAACGCTGGATAATTCGTCAGAAAAGACACTATATCCAGCGAGAGATACAGCAGGAAGAGGCCGAGTCAGAGGAGATAATT
TRN  10010101100011000
NAM  Q54049_9ENTR/1-147
ASQ  MHSLTRIKVLQRRCTVFHSQCESILLRYQDEDRRLQAEEEAIVEQIAGLKLLLDTLRAEKRLLSREEIYSLLRKQSIIRRQIKDLELQTTQIQEKRNELEKKREEFQEKSKYWLRKEGNYQRWITRQKRLYIQREIQQEEAESEEII
DSQ  ATGCATTCGCTGACCAGAATTAAAGTACTACAGCGGCGCTGTACGGTATTTCATTCACAGTGTGAGTCGATATTACTTCGCTATCAGGATGAGGACCGCAGACTGCAGGCCGAGGAGGAGGCGATCGTTGAACAAATCGCGGGTCTGAAATTGCTATTAGATACGCTGCGTGCAGAAAAGAGACTGCTAAGTCGTGAGGAAATTTATTCGTTATTACGTAAGCAGTCTATTATTCGCCGGCAGATAAAAGATTTAGAACTCCAGACTACACAAATTCAGGAAAAACGGAACGAGCTGGAAAAGAAAAGGGAAGAGTTTCAGGAAAAAAGTAAATATTGGTTGCGCAAAGAAGGGAACTATCAACGTTGGATAACCCGTCAGAAAAGACTTTATATTCAGCGAGAGATACAGCAGGAAGAGGCCGAGTCAGAGGAGATAATT
TRN  10010101100011000
//