EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02075 - RuvC)
FAM  PF02075
PID  RuvC
DES  Crossover junction endodeoxyribonuclease RuvC
IPR  IPR002176
ANO  10
ALN  152
AID  0.41629
APH  (((((RUVC_PSEAE/4-150:0.36576,(RUVC_HAEIN/4-150:0.09729,RUVC_ECOLI/3-149:0.09213):0.15970):0.30653,(RUVC_CHLPN/5-156:0.60345,RUVC_TREPA/19-167:0.45494):0.08968):0.13422,(RUVC_MYCTU/3-152:0.06596,RUVC_MYCLE/3-152:0.09310):0.59383):0.16934,RUVC_RICPR/3-150:0.75281):0.69366,RUVC_HELPJ/3-150:0.00000,RUVC_HELPY/3-150:0.00000);
ATP  (((((RUVC_PSEAE/4-150,(RUVC_HAEIN/4-150,RUVC_ECOLI/3-149)),(RUVC_CHLPN/5-156,RUVC_TREPA/19-167)),(RUVC_MYCTU/3-152,RUVC_MYCLE/3-152)),RUVC_RICPR/3-150),RUVC_HELPJ/3-150,RUVC_HELPY/3-150);
ATL  4.68061
DNO  9
DLN  456
DID  0.492378
DPH  ((((RUVC_TREPA/19-167:0.39082,(RUVC_PSEAE/4-150:0.45180,(RUVC_HAEIN/4-150:0.23987,RUVC_ECOLI/3-149:0.13629):0.07529):0.20338):0.11552,RUVC_CHLPN/5-156:0.41870):0.11968,(RUVC_MYCTU/3-152:0.15462,RUVC_MYCLE/3-152:0.05947):0.43011):0.59635,RUVC_HELPJ/3-150:0.02605,RUVC_HELPY/3-150:0.00828);
DTP  ((((RUVC_TREPA/19-167,(RUVC_PSEAE/4-150,(RUVC_HAEIN/4-150,RUVC_ECOLI/3-149))),RUVC_CHLPN/5-156),(RUVC_MYCTU/3-152,RUVC_MYCLE/3-152)),RUVC_HELPJ/3-150,RUVC_HELPY/3-150);
DTL  3.42622
RID  0.433917
RPH  (((RUVC_MYCTU/3-152:0.05288,RUVC_MYCLE/3-152:0.10635):0.54881,((RUVC_TREPA/19-167:0.48389,RUVC_CHLPN/5-156:0.57349):0.10327,(RUVC_PSEAE/4-150:0.34915,(RUVC_HAEIN/4-150:0.10027,RUVC_ECOLI/3-149:0.08934):0.17356):0.29722):0.14278):0.81895,RUVC_HELPJ/3-150:0.00000,RUVC_HELPY/3-150:0.00000);
RTP  (((RUVC_MYCTU/3-152,RUVC_MYCLE/3-152),((RUVC_TREPA/19-167,RUVC_CHLPN/5-156),(RUVC_PSEAE/4-150,(RUVC_HAEIN/4-150,RUVC_ECOLI/3-149)))),RUVC_HELPJ/3-150,RUVC_HELPY/3-150);
RTL  3.84111
LNK  RUVC_CHLPN/5-156:Q9Z7T3:AE001646
LNK  RUVC_ECOLI/3-149:P24239:X59551
LNK  RUVC_HAEIN/4-150:P44633:U32717
LNK  RUVC_HELPJ/3-150:Q9ZKX3:AE001510
LNK  RUVC_HELPY/3-150:O25544:AE000597
LNK  RUVC_MYCLE/3-152:P40834:U00011
LNK  RUVC_MYCTU/3-152:P66760:BX842580
LNK  RUVC_PSEAE/4-150:Q51424:D83138
LNK  RUVC_RICPR/3-150:Q9ZE29:
LNK  RUVC_TREPA/19-167:O83530:AE001227
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RUVC_MYCLE/3-152
ASQ  VMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVSDVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDVHFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTP--ADAADALALAICH
DSQ  GTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGTCGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGGTGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGCGATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCATCGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCACAAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTACATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGCCGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGCAAGCTAAACCGACACCG------GCCGATGCGGCCGACGCGTTGGCCCTGGCGATCTGCCAC
TRN  10010101100011011
NAM  RUVC_MYCTU/3-152
ASQ  VMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTP--ADAADALALAICH
DSQ  GTGATGGGTGTCGATCCCGGGTTGACCCGATGCGGGCTGTCGCTTATCGAGAGTGGGCGTGGTCGGCAGCTCACCGCGCTGGATGTCGACGTGGTGCGCACACCGTCGGATGCGGCCTTGGCGCAGCGCCTGTTGGCCATCAGCGATGCCGTCGAGCACTGGCTGGACACCCATCATCCGGAGGTGGTGGCTATCGAACGGGTGTTCTCTCAGCTCAACGTGACCACGGTGATGGGCACCGCGCAGGCCGGCGGCGTGATCGCCCTGGCGGCGGCCAAACGTGGTGTCGACGTGCATTTCCATACCCCCAGCGAGGTCAAGGCGGCGGTCACTGGCAACGGTTCCGCAGACAAGGCTCAGGTCACCGCGATGGTCACCAAAATCCTTGCGCTGCAAGCTAAACCGACACCG------GCCGACGCGGCCGACGCTTTGGCGCTGGCGATCTGTCAC
TRN  11011101101011011
NAM  RUVC_ECOLI/3-149
ASQ  ILGIDPGSRVTGYGVIRQ-VGRQLSYLGSGCIRTKVD-DLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQ---ADAADALAIAITH
DSQ  ATTCTCGGCATTGATCCGGGTTCGCGCGTGACCGGCTACGGCGTCATCCGCCAG---GTAGGTAGGCAACTGTCCTACCTGGGTAGCGGATGCATCCGCACCAAAGTGGAT---GATTTACCGTCTCGTCTGAAACTCATCTATGCGGGCGTGACGGAAATCATCACCCAGTTCCAGCCTGATTATTTCGCCATTGAACAAGTCTTTATGGCAAAGAACGCTGACTCAGCCCTGAAACTGGGCCAGGCGCGCGGCGTGGCGATTGTGGCGGCGGTGAATCAGGAGTTGCCAGTATTTGAATACGCGGCACGTCAGGTAAAGCAAACGGTGGTAGGTATTGGCAGTGCCGAAAAAAGCCAGGTGCAGCATATGGTCCGCACCTTGCTGAAACTGCCCGCTAATCCACAG---------GCGGATGCCGCCGATGCGCTGGCGATTGCTATCACCCAC
TRN  10010101100011000
NAM  RUVC_HAEIN/4-150
ASQ  ILGIDPGSRVTGYGVIRQ-TGKHLEYLGSGAIRTQVE-DLPTRLKRIYAGVTEIITQFQPNMFAIEQVFMAKNADSALKLGQARGTAIVAAVNNDLPVFEYAARLVKQTVVGIGSADKVQVQEMVTRILKLSDKPQ---ADAADALAIAITH
DSQ  ATTTTAGGTATTGACCCAGGCTCTCGCGTAACTGGTTACGGTGTGATTCGTCAA---ACAGGAAAACATTTAGAATATCTCGGTAGTGGCGCAATTCGTACTCAAGTTGAA---GATTTACCCACCCGTTTGAAACGCATTTATGCTGGAGTAACTGAAATCATCACGCAATTTCAACCTAATATGTTTGCGATTGAGCAAGTGTTTATGGCGAAGAATGCGGATTCAGCATTGAAACTTGGGCAGGCTCGCGGCACGGCGATTGTTGCAGCGGTAAATAATGATTTACCTGTTTTTGAATATGCCGCACGTTTAGTAAAACAAACAGTGGTGGGCATTGGTTCCGCTGATAAAGTGCAAGTGCAAGAAATGGTGACTCGTATTTTGAAGTTGTCAGATAAACCTCAA---------GCCGATGCAGCGGATGCGTTGGCTATTGCGATTACACAC
TRN  11011101111011000
NAM  RUVC_PSEAE/4-150
ASQ  ILGIDPGSRITGFGVVRE-TARGCEYVASGCIRTGNG-PLHERLHVVFRSVREVIRTHGPTALSIEQVFMARNADSALKLGQARGAAIVAAMEEGLSVAEYTASQVKQAVVGTGGADKQQVQMMVMHLLKLTQKPQ---IDASDALAIALCH
DSQ  ATTCTAGGGATTGACCCGGGCTCGCGCATCACCGGCTTCGGCGTGGTGCGGGAA---ACGGCGCGCGGTTGCGAATACGTGGCGTCCGGATGTATACGGACCGGTAATGGC---CCCTTGCACGAGCGTCTACACGTGGTGTTTCGCAGCGTCCGCGAGGTGATCCGCACCCATGGCCCGACGGCCCTGAGCATCGAGCAGGTGTTCATGGCGCGCAACGCCGATTCGGCCCTGAAGCTGGGGCAGGCGCGGGGGGCGGCCATCGTCGCGGCAATGGAGGAGGGGTTGAGCGTGGCGGAGTACACCGCCTCGCAGGTCAAGCAGGCAGTCGTGGGGACCGGCGGTGCAGACAAGCAGCAGGTGCAGATGATGGTCATGCATCTGTTGAAGCTGACCCAGAAACCGCAG---------ATAGATGCTTCCGACGCCCTGGCCATCGCCCTGTGTCAT
TRN  10010101100011011
NAM  RUVC_TREPA/19-167
ASQ  IVGIDPGLESTGYGVIEA-GGGSLRCLTYGVIVTQSNQPSAARLRHIFDTLQQVISIYQPQYCAVETIYFAKNVTSALCVAQARGVVLLAMAQQHISVAEYAPNAIKKAITGIAQAEKRQVQHLVKILLNLKDIPHP--DHAADALAVAVTH
DSQ  ATAGTGGGTATTGACCCAGGACTTGAATCTACCGGATACGGCGTTATAGAAGCA---GGGGGAGGCAGTCTGCGCTGTCTTACCTACGGGGTGATTGTTACCCAAAGCAATCAGCCATCTGCTGCACGACTCAGACACATCTTCGATACCCTGCAACAGGTAATCTCAATATATCAACCTCAGTATTGCGCAGTGGAGACAATCTATTTCGCAAAGAATGTAACCAGTGCGTTGTGTGTTGCGCAAGCGCGTGGGGTTGTATTACTTGCTATGGCACAACAGCACATTTCAGTAGCTGAATACGCACCGAATGCGATTAAAAAAGCAATAACTGGTATTGCCCAAGCAGAAAAAAGACAGGTACAGCATTTGGTAAAAATTTTACTCAATCTTAAGGATATACCTCATCCT------GATCACGCTGCTGATGCCCTAGCGGTTGCTGTTACCCAT
TRN  10010101100011000
NAM  RUVC_CHLPN/5-156
ASQ  IIGVDPGTIVAGYAIIAVEQRYQLRPYSYGAIRLSSDMPLPMRYKTLFEQLSGVLDDTQPNAMVLETQFVNKNPQSTMKLAMARGIVLLAAAQRDILIFEYAPNVAKKAVVGKGHASKRQVQVMVSKILNVPEVLHPSNEDIADAFALAICH
DSQ  ATTATAGGTGTGGATCCAGGAACGATAGTCGCAGGATATGCCATCATTGCAGTGGAACAGCGCTATCAATTACGTCCTTATAGTTATGGTGCCATTCGTTTATCTTCCGACATGCCACTGCCTATGCGCTATAAGACTTTGTTTGAGCAACTCTCAGGAGTATTAGATGATACGCAACCTAATGCTATGGTCCTAGAAACGCAATTTGTAAATAAGAATCCTCAAAGTACTATGAAATTAGCTATGGCACGAGGAATCGTTTTATTGGCTGCAGCTCAGCGTGATATCCTCATTTTTGAATATGCCCCAAATGTTGCTAAGAAAGCAGTAGTCGGTAAGGGTCATGCAAGTAAAAGACAGGTCCAGGTGATGGTAAGCAAGATTCTAAATGTTCCCGAAGTTTTGCACCCTTCGAATGAAGATATTGCTGATGCCTTTGCACTTGCTATATGTCAT
TRN  10010101100011000
NAM  RUVC_HELPY/3-150
ASQ  ILGIDPGSRKCGYAIISH-ASNKLSLITAGFINITTT-RLQEQILDLIEALDCLLDRYEVNEVAIEDIFFGYNPKSVIKLAQFRGALSLKILERIGNFSEYTPLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKP--LDISDAIAVAITH
DSQ  ATTTTAGGAATAGATCCGGGCAGTAGGAAATGCGGGTATGCTATCATTTCTCAC---GCTTCTAACAAGCTTTCTTTAATCACGGCCGGGTTCATTAATATCACCACGACA---CGCTTGCAAGAACAGATTTTAGATTTGATAGAAGCCTTAGATTGCTTATTGGATCGTTACGAAGTCAATGAAGTGGCGATTGAAGATATTTTCTTTGGGTATAACCCAAAAAGCGTGATCAAGCTCGCGCAATTCAGGGGAGCGTTGTCCTTAAAGATTTTAGAAAGGATTGGTAATTTTAGCGAATACACGCCCTTACAAGTCAAAAAAGCCCTGACCGGTAACGGGAAAGCCGCTAAAGAACAAGTAGCTTTTATGGTCAAGCGCTTGCTTAACATCACAAGCGAAATCAAGCCT------TTGGATATTAGCGATGCGATAGCCGTTGCTATCACGCAT
TRN  10010101100011010
NAM  RUVC_HELPJ/3-150
ASQ  ILGIDPGSRKCGYAIISH-ASNKLSLITAGFINITTT-RLQEQILDLIEALDCLLDRYEVNEVAIEDIFFGYNPKSVIKLAQFRGALSLKILERIGNFSEYTPLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKP--LDISDAIAVAITH
DSQ  ATTTTAGGAATAGACCCAGGCAGTAGGAAATGCGGGTATGCTATCATTTCTCAC---GCTTCCAACAAGCTTTCTTTAATCACGGCCGGGTTCATTAATATCACCACGACA---CGCTTGCAAGAACAGATTTTAGACTTGATAGAAGCCTTAGATTGTTTATTGGATCGTTACGAAGTCAATGAAGTAGCGATTGAAGATATTTTCTTTGGGTATAACCCTAAAAGCGTGATCAAACTCGCGCAATTCAGGGGGGCGTTGTCCTTAAAGATTTTAGAAAGGATCGGTAATTTTAGCGAATACACGCCCTTACAAGTCAAAAAAGCCCTTACCGGTAACGGGAAAGCCGCTAAAGAGCAAGTGGCCTTTATGGTCAAACGCTTGCTTAACATCACAAGCGAAATCAAGCCT------TTGGATATTAGCGATGCGATAGCCGTTGCTATCACGCAT
TRN  10010101110011010
NAM  RUVC_RICPR/3-150
ASQ  VLGIDPALGKLGWAVVAK-ESTKLHYLASGTIKTHSKDEIHNRLAFINSILEKVILEYQPNIAAIEETFVNTNNVTSLKLGYARGAIMSLIGRYNLDMQEFKPNTVKKTVTGYGHAGKEQILYMIKHLISGTDLITN--SDEADAVALAYT-
//