EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02074 - Peptidase_M32)
FAM  PF02074
PID  Peptidase_M32
DES  Carboxypeptidase Taq (M32) metallopeptidase
IPR  IPR001333
ANO  3
ALN  508
AID  0.385331
APH  (O58210_PYRHO/20-514:0.73180,YPWA_BACSU/1-495:0.51456,CTAQ_THEAQ/1-505:0.65179);
ATP  (O58210_PYRHO/20-514,YPWA_BACSU/1-495,CTAQ_THEAQ/1-505);
ATL  1.89815
DNO  3
DLN  1524
DID  0.460366
DPH  (O58210_PYRHO/20-514:0.46444,YPWA_BACSU/1-495:0.46008,CTAQ_THEAQ/1-505:0.54196);
DTP  (O58210_PYRHO/20-514,YPWA_BACSU/1-495,CTAQ_THEAQ/1-505);
DTL  1.46648
RID  0.385331
RPH  (O58210_PYRHO/20-514:0.73180,YPWA_BACSU/1-495:0.51456,CTAQ_THEAQ/1-505:0.65179);
RTP  (O58210_PYRHO/20-514,YPWA_BACSU/1-495,CTAQ_THEAQ/1-505);
RTL  1.89815
LNK  CTAQ_THEAQ/1-505:P42663:D17669
LNK  O58210_PYRHO/20-514:O58210:BA000001
LNK  YPWA_BACSU/1-495:P50848:Z99115
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O58210_PYRHO/20-514
ASQ  VFRNDTIKEILQKYRRIWALGHAQSVLGWDLEVNMPKEGILERSVAQGELSVLSQELLLKPEFVELVEKAKGI---EDLNEYERGVVRVLDRQIRIMKSFPPEFLKEVSETTSKATKAWEEAKAKDDFSKFEPWLDKIISLAKR---AAEYLG-YEEEP-----YDALLDLYEEGLRTRDVVKMFDVLEKELRPLLEKILEEDKVPREHPLEKEKYEREWMEKVNLWVLEKFGYPLGTRARLDVSAHPFTTEFGIRDVRITTRYEGFDFRRALLSTIHEFGHALYELQQDERFMFTPIAGGVSLGIHESQSRFWENIIGRSKEFVEFIYPVLKENL-PFMEKYTQEDVYLYFNMVRPDFIRTEADVVTYNFHVLLRFKLERMMVSEDVKAKDLPEMWNDEMERLLGIRPKTYREGILQDIHWAHGSIGYFPTYSIGTILSAQLYYHIKKDIPDFEEKVAKGEFEPIKSWLREKIHRWGSIYPPKELLKKAIGEDVNAEYFVRWIKERY
DSQ  GTTTTTAGAAATGATACAATTAAGGAGATCCTTCAAAAGTATAGGAGAATTTGGGCTCTAGGGCATGCTCAGAGCGTCCTAGGTTGGGATCTTGAAGTTAACATGCCTAAGGAGGGAATACTAGAGAGGTCAGTGGCCCAGGGAGAGCTCTCAGTCCTTTCCCAGGAACTGTTGCTAAAACCAGAGTTCGTTGAACTAGTTGAGAAGGCTAAAGGAATT---------GAAGACCTAAACGAATATGAAAGAGGAGTTGTTAGAGTCCTTGATAGGCAGATAAGGATAATGAAGTCCTTCCCGCCTGAATTCCTAAAGGAGGTGAGTGAAACAACTTCAAAGGCTACAAAAGCTTGGGAGGAAGCCAAGGCTAAGGATGACTTCTCGAAGTTTGAGCCATGGCTGGATAAGATAATCAGCCTAGCAAAGAGG---------GCAGCGGAGTACCTAGGT---TACGAAGAGGAGCCT---------------TATGACGCTTTACTGGATCTTTACGAAGAGGGTCTTAGAACTAGGGATGTAGTTAAGATGTTTGATGTTCTTGAGAAGGAGCTTAGACCTTTGCTCGAGAAGATACTAGAGGAAGATAAGGTCCCAAGGGAACACCCGCTAGAGAAGGAGAAATATGAAAGGGAGTGGATGGAGAAGGTCAACCTCTGGGTACTTGAGAAGTTCGGTTATCCTCTAGGCACCAGAGCAAGACTTGATGTTTCGGCTCATCCGTTTACAACGGAGTTTGGAATAAGGGATGTTAGAATAACAACCCGTTACGAGGGCTTTGATTTCAGGAGAGCTTTGTTAAGTACGATTCACGAGTTCGGTCATGCACTATATGAGCTTCAGCAGGATGAAAGGTTCATGTTCACTCCAATAGCTGGTGGAGTAAGCCTTGGAATTCATGAGAGCCAGTCCAGGTTCTGGGAGAACATAATAGGTAGAAGCAAAGAGTTCGTCGAGTTTATATACCCTGTACTCAAGGAAAACTTA---CCCTTCATGGAAAAGTACACCCAGGAGGATGTTTACCTCTACTTCAACATGGTCAGGCCTGACTTCATAAGGACGGAAGCCGATGTAGTAACCTACAACTTCCACGTCCTCTTGAGGTTCAAGCTCGAGAGGATGATGGTAAGCGAGGATGTCAAAGCTAAGGATCTCCCTGAGATGTGGAACGATGAGATGGAGAGGTTGCTGGGGATAAGGCCTAAAACCTATAGGGAGGGAATCCTTCAGGATATCCACTGGGCCCACGGAAGCATAGGCTACTTCCCGACCTACAGCATAGGGACGATACTCTCAGCTCAACTGTACTATCACATAAAGAAGGATATCCCTGACTTTGAAGAAAAGGTTGCTAAAGGTGAGTTTGAACCGATAAAGTCCTGGCTCAGGGAAAAGATACACAGGTGGGGCAGCATCTATCCACCTAAGGAGCTACTAAAGAAAGCTATAGGTGAAGATGTAAACGCTGAATACTTCGTTAGGTGGATTAAGGAGAGGTAT
TRN  10010101100011000
NAM  YPWA_BACSU/1-495
ASQ  MEIHTYEKEFFDLLKRISHYSEAVALMHWDSRTGAPKNGSEDRAESIGQLSTDIFNIQTSDRMKELIDVLYER--FDDLSEDTKKAVELAKKEYEENKKIPEAEYKEYVILCSKAETAWEEAKGKSDFSLFSPYLEQLIEFNKR---FITYWG-YQEHP-----YDALLDLFEPGVTVKVLDQLFAELKEAIIPLVKQVTASGNKPDTSFITK-AFPKEKQKELSLYFLQELGYDFDG-GRLDETVHPFATTLNRGDVRVTTRYDEKDFRTAIFGTIHECGHAIYEQNIDEALSGTNLSDGASMGIHESQSLFYENFIGRNKHFWTPYYKKIQEASPVQFKDISLDDFVRAINESKPSFIRVEADELTYPLHIIIRYEIEKAIFSNEVSVEDLPSLWNQKYQDYLGITPQTDAEGILQDVHWAGGDFGYFPSYALGYMYAAQLKQKMLEDLPEFDALLERGEFHPIKQWLTEKVHIHGKRKKPLDIIKDATGEELNVRYLIDYLSNKY
DSQ  ATGGAGATACATACATATGAAAAAGAATTTTTTGATCTTTTAAAAAGAATCTCACATTACAGCGAAGCAGTTGCGTTAATGCACTGGGACTCCAGAACAGGCGCGCCGAAAAATGGCTCAGAGGATCGTGCCGAAAGTATCGGCCAGCTTTCAACAGATATATTCAATATCCAAACATCAGATCGAATGAAGGAGCTTATCGATGTCCTGTATGAACGA------TTTGATGACTTGTCGGAAGATACGAAAAAAGCAGTGGAACTGGCGAAAAAAGAGTATGAAGAGAATAAGAAAATCCCTGAGGCTGAATACAAAGAATACGTGATTCTGTGTTCAAAGGCAGAAACAGCGTGGGAGGAAGCGAAAGGAAAATCTGATTTCAGCTTGTTTTCTCCTTATTTAGAACAGCTGATTGAATTCAATAAACGT---------TTTATTACGTATTGGGGA---TATCAAGAGCATCCT---------------TATGATGCATTGCTTGATTTGTTTGAGCCCGGCGTCACGGTAAAGGTGCTTGATCAGTTGTTTGCTGAGCTGAAGGAAGCGATTATCCCTCTTGTTAAACAGGTGACAGCTTCCGGAAATAAACCAGATACAAGCTTTATTACAAAA---GCGTTCCCGAAAGAAAAGCAAAAAGAGCTCAGTCTGTATTTTTTACAGGAGCTTGGCTACGATTTTGATGGC---GGAAGACTTGATGAAACCGTTCATCCGTTTGCAACTACGCTGAATCGGGGAGACGTTCGGGTCACGACGAGATATGATGAAAAAGATTTCCGGACGGCGATCTTTGGGACCATTCATGAGTGCGGGCACGCGATTTACGAGCAAAATATTGATGAAGCACTCAGTGGCACGAACTTGTCAGACGGCGCATCGATGGGAATTCATGAATCGCAATCATTATTTTACGAGAATTTTATCGGCCGCAACAAGCATTTTTGGACTCCGTACTATAAGAAGATTCAAGAGGCATCACCTGTACAGTTCAAGGACATCTCCCTGGATGATTTTGTCCGGGCAATCAATGAATCAAAACCTTCATTTATCAGGGTCGAAGCGGATGAATTGACGTATCCTCTTCATATCATCATCCGTTATGAAATTGAAAAAGCGATTTTCAGCAATGAAGTGTCTGTGGAAGATCTGCCGTCGCTTTGGAATCAAAAATACCAGGATTATTTAGGGATTACACCGCAGACCGACGCAGAGGGGATTTTACAGGACGTCCATTGGGCAGGTGGAGATTTCGGCTACTTCCCATCCTATGCGCTCGGCTACATGTATGCGGCTCAGCTGAAACAAAAAATGCTTGAGGATCTCCCTGAATTTGACGCTCTCTTGGAAAGAGGAGAGTTCCATCCGATAAAGCAATGGCTGACGGAAAAGGTGCACATTCACGGAAAACGGAAAAAGCCGTTAGACATTATTAAAGATGCAACAGGAGAAGAGCTGAATGTTCGCTATTTAATTGATTATTTATCAAACAAATAT
TRN  10010101100011000
NAM  CTAQ_THEAQ/1-505
ASQ  MTPEAAYQNLLEFQRETAYLGSLGALAAWDQRTMIPRKGHGHRARQMAALARLLHERATDPRIGEWLEKVEGSSLVEDPLSDAAVNVRAWRRAYERARAIPERLAVELAQARSEGETAWEALRPRDDWQGFLPYLKRLFALAKEEAEILMAVGPDPLDPPYGELYDALLDGYEPGARARDLEPLFRELSSGLKGLLDRILGSGRRPDVGVLHR-HYPKEAQRAFALELLQACGYDLEA-GRLDPTAHPFEIAIGPGDVRITTRYYEDFFNAGIFGTLHEMGHALYEQGLPEAHWGTPRGEAASLGVHESQSRTWENLVGRSLGFWERFFPRAKEVF-SSLADVRLEDFHFAVNAVEPSLIRVEADEVTYNLHILVRLELELALFRGELFLEDLPEAWREKYRAYLGVAPRDYKDGVMQDVHWSGGMFGYFPTYTLGNLYAAQFFAKAQEELGPLEPLFARGEFTPFLDWTRRKIHAEGSRFRPRALVERVTGSPPGAQAFLRYLEAKY
DSQ  GTGACGCCGGAAGCCGCTTATCAGAACCTGTTGGAGTTCCAGAGGGAAACCGCCTACCTGGGTTCCTTAGGGGCCCTGGCCGCCTGGGACCAGCGCACCATGATCCCCAGAAAGGGGCACGGGCACCGGGCCCGGCAGATGGCCGCTCTGGCCCGCCTCCTCCACGAGCGGGCCACCGACCCCAGGATCGGGGAGTGGCTGGAGAAGGTGGAGGGGTCGTCCCTGGTGGAGGACCCCCTTTCCGATGCCGCCGTCAACGTGCGGGCCTGGCGGCGGGCCTACGAGAGGGCCCGGGCCATTCCCGAGAGGCTGGCTGTGGAGCTGGCCCAGGCCAGGAGCGAGGGGGAGACCGCCTGGGAGGCCCTGCGCCCCAGGGACGACTGGCAGGGCTTCCTGCCCTACCTCAAGCGCCTTTTCGCCCTGGCCAAGGAGGAGGCGGAGATCCTCATGGCCGTGGGGCCAGACCCCCTGGACCCCCCCTACGGGGAGCTTTACGACGCCCTCCTGGACGGCTACGAGCCCGGGGCCAGGGCGAGGGACCTCGAGCCCCTCTTCCGGGAGCTCTCCTCGGGCCTCAAGGGTCTTCTGGACCGCATCCTGGGAAGCGGGCGGAGGCCCGACGTCGGCGTCCTCCACCGC---CACTACCCTAAGGAGGCCCAGAGGGCCTTCGCCTTAGAGCTCCTTCAGGCCTGCGGGTACGACCTCGAGGCC---GGCCGTCTGGACCCCACCGCCCACCCCTTTGAGATCGCCATCGGCCCCGGGGACGTGCGCATCACCACCCGCTACTACGAGGACTTCTTCAACGCCGGCATCTTCGGCACCCTCCACGAGATGGGCCACGCCCTCTACGAGCAGGGCCTGCCCGAGGCCCACTGGGGCACCCCCCGGGGGGAGGCCGCCTCCTTGGGGGTCCACGAGTCCCAAAGCCGCACCTGGGAGAACCTGGTGGGCCGCTCCTTGGGCTTCTGGGAGCGCTTCTTCCCCCGGGCCAAGGAGGTCTTT---TCCAGTCTGGCCGACGTGCGCCTGGAGGACTTCCACTTCGCCGTCAACGCCGTGGAGCCCTCCCTGATCCGGGTGGAGGCCGACGAGGTTACCTATAACCTCCACATCCTGGTGCGCCTGGAGCTGGAGCTGGCCCTATTCCGGGGGGAGCTTTTCCTCGAGGACCTGCCCGAGGCCTGGCGGGAAAAGTACCGGGCCTACCTGGGCGTGGCCCCAAGGGACTACAAGGACGGGGTCATGCAGGACGTCCACTGGTCGGGGGGGATGTTCGGCTACTTCCCCACCTACACCCTGGGCAACCTCTACGCTGCCCAGTTCTTCGCCAAGGCCCAGGAGGAGCTTGGGCCCTTGGAGCCCCTCTTCGCCCGCGGGGAGTTCACCCCCTTCCTGGACTGGACCAGGCGCAAGATCCACGCCGAGGGGAGCCGCTTCCGCCCCCGGGCCCTGGTGGAGAGGGTGACGGGAAGCCCCCCCGGCGCTCAAGCCTTCCTCAGGTACCTGGAGGCCAAGTAC
TRN  10010101100011010
//