EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02068 - Metallothio_PEC)
FAM  PF02068
PID  Metallothio_PEC
DES  Plant PEC family metallothionein
IPR  IPR000316
ANO  4
ALN  80
AID  0.59238
APH  ((EC1_ARATH/12-84:0.31179,Q9ZTM1_PETHY/10-88:0.33723):0.44642,EC1_WHEAT/1-77:0.16870,EC_MAIZE/1-75:0.10548);
ATP  ((EC1_ARATH/12-84,Q9ZTM1_PETHY/10-88),EC1_WHEAT/1-77,EC_MAIZE/1-75);
ATL  1.36962
DNO  3
DLN  240
DID  0.659347
DPH  (Q9ZTM1_PETHY/10-88:0.57824,EC1_WHEAT/1-77:0.11921,EC_MAIZE/1-75:0.08152);
DTP  (Q9ZTM1_PETHY/10-88,EC1_WHEAT/1-77,EC_MAIZE/1-75);
DTL  0.77897
RID  0.610597
RPH  (Q9ZTM1_PETHY/10-88:0.73659,EC1_WHEAT/1-77:0.15933,EC_MAIZE/1-75:0.11325);
RTP  (Q9ZTM1_PETHY/10-88,EC1_WHEAT/1-77,EC_MAIZE/1-75);
RTL  1.00917
LNK  EC1_ARATH/12-84:P93746:
LNK  EC1_WHEAT/1-77:P30569:X68289
LNK  EC_MAIZE/1-75:P43401:Z34469
LNK  Q9ZTM1_PETHY/10-88:Q9ZTM1:AF049937
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9ZTM1_PETHY/10-88
ASQ  ICDERCGCPSPCPGGVACRCASGGAATAGGGDMEHKKCPCGEHCGCNPCTCPKSEGTTAGSGK-AHCKCGPGCTCVQCAS
DSQ  ATCTGCGACGAAAGGTGTGGCTGTCCATCTCCCTGCCCTGGTGGTGTTGCTTGCAGGTGTGCGTCAGGAGGGGCGGCGACAGCAGGTGGGGGGGATATGGAGCACAAGAAATGCCCATGTGGAGAACACTGCGGATGCAATCCATGCACATGTCCAAAGAGTGAGGGCACCACTGCTGGTAGTGGCAAG---GCTCACTGCAAGTGCGGTCCTGGCTGCACCTGTGTCCAGTGTGCCTCT
TRN  10110101110011001
NAM  EC1_ARATH/12-84
ASQ  GCNDSCGCPSPCPGGNSCRCRMR---EASAGDQGHMVCPCGEHCGCNPCNCPKTQTQTSAKG----CTCGEGCTCASCAT
NAM  EC1_WHEAT/1-77
ASQ  GCDDKCGCAVPCPGGTGCRCTSAR---SGAAAGEHTTCGCGEHCGCNPCACGREGTPSGRANRRANCSCGAACNCASCGS
DSQ  GGCTGCGACGACAAGTGCGGGTGCGCCGTGCCGTGCCCCGGCGGCACGGGCTGCAGGTGCACCTCGGCGAGG---------AGCGGCGCGGCGGCGGGGGAGCACACGACGTGCGGGTGCGGCGAGCACTGTGGGTGCAACCCGTGCGCGTGCGGGCGCGAGGGGACGCCGTCCGGGCGGGCGAACAGGAGGGCCAACTGCTCCTGCGGCGCGGCCTGCAACTGCGCTTCATGCGGCTCG
TRN  10110101110011001
NAM  EC_MAIZE/1-75
ASQ  GCDDKCGCAVPCPGGKDCRCTSG-----SGGQREHTTCGCGEHCECSPCTCGRATMPSGRENRRANCSCGASCNCASCAS
DSQ  GGGTGCGACGACAAGTGCGGGTGCGCCGTGCCGTGCCCCGGCGGCAAAGACTGCAGGTGCACGTCGGGG---------------AGCGGCGGGCAGCGGGAGCACACGACTTGCGGCTGCGGGGAGCACTGCGAGTGCAGCCCGTGCACGTGTGGCCGGGCCACGATGCCGTCCGGCCGCGAGAACAGGAGGGCTAACTGCTCCTGCGGGGCGTCCTGCAACTGCGCATCCTGCGCCTCG
TRN  10110101110011011
//