EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02059 - IL3)
FAM  PF02059
PID  IL3
DES  Interleukin-3
IPR  IPR002183
ANO  5
ALN  121
AID  0.374913
APH  ((IL3_PANTR/20-137:0.17683,IL3_SAGOE/19-136:0.18141):0.55730,(P97688_RAT/27-141:0.45535,IL3_MOUSE/27-138:0.22533):0.94635,IL3_BOVIN/18-132:0.70660);
ATP  ((IL3_PANTR/20-137,IL3_SAGOE/19-136),(P97688_RAT/27-141,IL3_MOUSE/27-138),IL3_BOVIN/18-132);
ATL  3.24917
DNO  5
DLN  363
DID  0.52747
DPH  ((IL3_PANTR/20-137:0.09460,IL3_SAGOE/19-136:0.09800):0.26002,(P97688_RAT/27-141:0.20546,IL3_MOUSE/27-138:0.08298):0.65224,IL3_BOVIN/18-132:0.39875);
DTP  ((IL3_PANTR/20-137,IL3_SAGOE/19-136),(P97688_RAT/27-141,IL3_MOUSE/27-138),IL3_BOVIN/18-132);
DTL  1.79205
RID  0.374913
RPH  ((IL3_PANTR/20-137:0.17683,IL3_SAGOE/19-136:0.18141):0.55730,(P97688_RAT/27-141:0.45535,IL3_MOUSE/27-138:0.22533):0.94635,IL3_BOVIN/18-132:0.70660);
RTP  ((IL3_PANTR/20-137,IL3_SAGOE/19-136),(P97688_RAT/27-141,IL3_MOUSE/27-138),IL3_BOVIN/18-132);
RTL  3.24917
LNK  IL3_BOVIN/18-132:P49875:L31893
LNK  IL3_MOUSE/27-138:P01586:K01850
LNK  IL3_PANTR/20-137:Q28809:X74875
LNK  IL3_SAGOE/19-136:P51445:X74878
LNK  P97688_RAT/27-141:P97688:U81492
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IL3_BOVIN/18-132
ASQ  APQAKGLPVVTSRTP-YSMLMKEIMDDLK--KITPSPEGSLNSDEKNFLTKESLLQANLKVFMTFATDTFGSD-SKIMKNLKEFQPVLPTAT--PTEDPIFIENKNLGDFRMKLEEYLVII
DSQ  GCTCCTCAGGCAAAGGGGTTGCCTGTCGTGACATCGAGGACTCCA---TATTCTATGTTGATGAAGGAAATTATGGATGACCTAAAG------AAAATAACTCCGAGTCCAGAAGGCTCCTTGAACTCAGATGAGAAGAATTTCCTGACGAAAGAGAGCCTTCTGCAGGCAAACCTGAAAGTATTCATGACATTTGCCACAGATACTTTTGGAAGCGAT---TCAAAAATCATGAAAAATCTTAAGGAATTCCAGCCAGTGCTGCCCACAGCCACA------CCCACGGAAGATCCAATTTTTATTGAGAACAAGAACTTGGGCGATTTCCGGATGAAATTGGAAGAATATTTGGTTATCATT
TRN  10010101100011001
NAM  IL3_PANTR/20-137
ASQ  APMTQTTSLKTSWVN-CSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFN-RAVKSLQNA-SAIESILKNLLPCLPLATAAPTRHPIRIKDGDWNEFRRKLTFYLKTL
DSQ  GCTCCCATGACCCAGACAACGTCCTTGAAGACAAGCTGGGTTAAC---TGCTCTAACATGATCGATGAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTCAAC---AGGGCTGTCAAGAGTTTACAGAACGCA---TCAGCAATTGAGAGCATTCTTAAAAATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCGTATCAAGGATGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTT
TRN  10010101100011000
NAM  IL3_SAGOE/19-136
ASQ  AAPTQTTSLKATQVN-CSNLREEIVTLLNQPPLPSSNFNNLNREDQRILMKPNLRRPNLEAFQ-KAVKSLQNA-TAIESSLKDLPLCLPMATNASMQHPIRIKDGDWNDFRMKLKFYLKTL
DSQ  GCTGCCCCAACCCAGACAACGTCCTTGAAGGCAACTCAGGTTAAC---TGCTCTAACTTGAGGGAGGAAATTGTAACACTCCTAAACCAGCCACCTTTGCCTTCATCCAACTTCAACAACTTAAACAGGGAAGACCAACGCATTCTGATGAAACCAAACCTTCGAAGGCCAAACCTAGAAGCATTCCAG---AAGGCCGTCAAGAGTTTACAGAACGCA---ACAGCAATTGAGAGCAGTCTTAAGGATCTGCCACTATGCCTGCCCATGGCCACGAATGCATCCATGCAACATCCAATCCGTATCAAGGACGGTGACTGGAATGACTTCCGGATGAAACTGAAGTTCTATTTGAAAACCCTT
TRN  10010101100011000
NAM  P97688_RAT/27-141
ASQ  ISDRGSDAHHLLRTLDCRTIALEILVKLPY----PQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLD--DFKKKLRFYVIHL
DSQ  ATTTCAGACAGGGGCTCAGATGCCCACCATTTACTCAGGACGTTGGATTGCAGGACTATTGCCTTGGAGATTTTGGTGAAGCTCCCATAT------------CCTCAGGTATCTGGACTCAATAATAGTGACGACAAAGCCAATCTGAGGAATAGTACCTTGCGGAGAGTAAACCTGGACGAATTCCTAAAAAGCCAAGAGGAGTTTGATTCTCAGGACACAACGGACATCAAGTCCAAACTTCAGAAACTTAAGTGTTGTATTCCTGCAGCTGCGAGCGACTCTGTGTTGCCAGGTGTCTACAATAAAGATCTGGAT------GACTTTAAGAAGAAACTGAGATTCTACGTGATCCATCTT
TRN  10010101100011000
NAM  IL3_MOUSE/27-138
ASQ  ASISGRDTHRLTRTLNCSSIVKEIIGKLP-------EPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLD--DFRKKLRFYMVHL
DSQ  GCTTCAATCAGTGGCCGGGATACCCACCGTTTAACCAGAACGTTGAATTGCAGCTCTATTGTCAAGGAGATTATAGGGAAGCTCCCA---------------------GAACCTGAACTCAAAACTGATGATGAAGGACCCTCTCTGAGGAATAAGAGCTTTCGGAGAGTAAACCTGTCCAAATTCGTGGAAAGCCAAGGAGAAGTGGATCCTGAGGACAGATACGTTATCAAGTCCAATCTTCAGAAACTTAACTGTTGCCTGCCTACATCTGCGAATGACTCTGCGCTGCCAGGGGTCTTCATTCGAGATCTGGAT------GACTTTCGGAAGAAACTGAGATTCTACATGGTCCACCTT
TRN  10010101100011000
//