EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02046 - COX6A)
FAM  PF02046
PID  COX6A
DES  Cytochrome c oxidase subunit VIa
IPR  IPR001349
ANO  6
ALN  113
AID  0.379621
APH  (CX6A2_RAT/12-94:0.25783,(CX6A1_HUMAN/24-109:0.04926,(COX6A_CAEEL/23-124:0.64916,(COX13_SCHPO/26-130:0.70568,COX13_YEAST/20-129:0.49598):0.27828):0.37768):0.14837,CX6A1_CYPCA/16-100:0.33363);
ATP  (CX6A2_RAT/12-94,(CX6A1_HUMAN/24-109,(COX6A_CAEEL/23-124,(COX13_SCHPO/26-130,COX13_YEAST/20-129))),CX6A1_CYPCA/16-100);
ATL  3.29587
DNO  5
DLN  339
DID  0.463459
DPH  ((CX6A1_HUMAN/24-109:0.21261,(COX13_SCHPO/26-130:0.54983,COX13_YEAST/20-129:0.35813):0.35494):0.10867,CX6A1_CYPCA/16-100:0.27440,COX6A_CAEEL/23-124:0.50931);
DTP  ((CX6A1_HUMAN/24-109,(COX13_SCHPO/26-130,COX13_YEAST/20-129)),CX6A1_CYPCA/16-100,COX6A_CAEEL/23-124);
DTL  2.36789
RID  0.349541
RPH  (((CX6A1_HUMAN/24-109:0.09161,CX6A1_CYPCA/16-100:0.45443):0.34881,COX6A_CAEEL/23-124:0.65711):0.27524,COX13_SCHPO/26-130:0.71518,COX13_YEAST/20-129:0.50425);
RTP  (((CX6A1_HUMAN/24-109,CX6A1_CYPCA/16-100),COX6A_CAEEL/23-124),COX13_SCHPO/26-130,COX13_YEAST/20-129);
RTL  3.04662
LNK  COX13_SCHPO/26-130:O74471:AL031540
LNK  COX13_YEAST/20-129:P32799:X72970
LNK  COX6A_CAEEL/23-124:Q20779:U12966
LNK  CX6A1_CYPCA/16-100:O13082:U83907
LNK  CX6A1_HUMAN/24-109:P12074:AL021546
LNK  CX6A2_RAT/12-94:P10817:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  COX13_YEAST/20-129
ASQ  PAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHI---EHDD
DSQ  CCTGCATTTGGCCCACCAGATAAAGTGGCAGCTCAAAAATTTAAAGAATCATTAATGGCCACTGAAAAGCATGCGAAGGACACATCTAATATGTGGGTTAAAATCTCAGTTTGGGTCGCCCTACCAGCAATTGCTTTAACAGCTGTGAACACATACTTTGTTGAAAAGGAGCATGCTGAGCATCGTGAACATTTGAAACATGTGCCAGACTCCGAATGGCCAAGGGATTACGAGTTTATGAATATCAGGTCTAAGCCTTTTTTCTGGGGTGACGGTGATAAGACATTATTCTGGAATCCTGTTGTCAACAGGCACATC---------GAGCACGACGAT
TRN  10010101110011000
NAM  COX13_SCHPO/26-130
ASQ  LSFRAYSNEAKVNWLEEVQAEEEHAKRSSEFWKKVTYYIGGPALILASANAYYIYCKHQEHAKH-----VEDTDPGYSFENLRFKKYPWGDGSKTLFWNDKVNHLK---KDDE
DSQ  CTCAGCTTTCGAGCTTATAGTAACGAAGCAAAGGTGAACTGGCTTGAAGAGGTTCAAGCAGAAGAGGAGCATGCAAAGCGTAGCAGTGAATTCTGGAAGAAAGTGACTTATTACATTGGTGGACCAGCATTGATATTGGCTAGTGCCAATGCGTATTATATTTATTGCAAGCATCAAGAGCATGCCAAGCAT---------------GTTGAAGATACGGACCCTGGTTATAGCTTTGAAAATTTGCGCTTCAAAAAGTATCCATGGGGAGACGGTAGCAAGACACTTTTCTGGAATGATAAAGTCAATCATTTAAAG---------AAGGATGATGAA
TRN  10010101110011010
NAM  COX6A_CAEEL/23-124
ASQ  SFYGSNNVEGFK---ESYVTPLKQAHNASETWKKIFFIASIPCLALTMYA---AFKDHKKHMSH-----ERPEHVEYAFLNVRNKPFPWSDGNHSLFHNKAEQFVPGVGFEAD
DSQ  TCATTTTACGGATCCAACAATGTCGAAGGATTCAAA---------GAGTCATATGTCACTCCACTCAAGCAAGCTCACAATGCTAGCGAGACCTGGAAGAAAATCTTCTTCATTGCTTCGATTCCATGCTTGGCTCTTACCATGTATGCC---------GCCTTCAAGGATCACAAAAAACACATGAGCCAC---------------GAACGCCCAGAGCACGTCGAGTACGCCTTCTTGAACGTTCGCAACAAGCCATTCCCATGGTCCGATGGAAATCACTCATTGTTCCACAACAAGGCGGAGCAATTTGTTCCAGGAGTTGGATTCGAGGCTGAC
TRN  11011101111011001
NAM  CX6A2_RAT/12-94
ASQ  ASKGDHGGAG------------------ANTWRLLTFVLALPSVALCSLN---CWMHAGHH--------ERPEFIPYHHLRIRTKPFSWGDGNHTLFHNPHVNPLP-TGYEQP
NAM  CX6A1_HUMAN/24-109
ASQ  MSSGAHGEEGS-----------------ARMWKTLTFFVALPGVAVSMLN---VYLKSHHGE-H-----ERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLP-TGYEDE
DSQ  ATGTCGAGTGGCGCCCATGGCGAAGAGGGCTCA---------------------------------------------------GCTCGCATGTGGAAGACTCTCACCTTCTTCGTCGCGCTCCCCGGGGTGGCAGTCAGCATGCTGAAT---------GTGTACCTGAAGTCGCACCACGGAGAG---CAC---------------GAGAGACCCGAGTTCATCGCCTACCCCCATCTCCGCATCAGGACCAAGCCGTTTCCCTGGGGAGATGGTAACCATACTCTATTCCATAACCCTCATGTGAATCCACTTCCA---ACTGGCTACGAAGATGAA
TRN  10010101100011001
NAM  CX6A1_CYPCA/16-100
ASQ  AASQGSHEGG------------------ARTWKILSFVLALPGVGVCMAN---AYMKMQAHS-H-----DPPEFVPYPHLRIRTKPWPWGDGNHSLFHNAHTNALP-TGYEGP
DSQ  GCTGCATCACAAGGGAGTCATGAAGGAGGA------------------------------------------------------GCAAGGACCTGGAAGATCCTGTCCTTCGTATTAGCTCTGCCCGGTGTGGGTGTCTGCATGGCAAAC---------GCTTACATGAAGATGCAGGCCCATTCC---CAT---------------GATCCCCCAGAGTTTGTGCCATACCCACACCTCCGCATTCGAACCAAGCCATGGCCATGGGGTGATGGGAATCACTCCCTCTTCCACAACGCTCACACGAACGCTCTGCCC---ACTGGTTACGAGGGACCT
TRN  10010101100011000
//