EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02041 - Auxin_BP)
FAM  PF02041
PID  Auxin_BP
DES  Auxin binding protein
IPR  IPR000526
ANO  4
ALN  170
AID  0.700978
APH  (P93271_MALDO/24-193:0.12849,(ABP1_TOBAC/19-187:0.07622,ABP1_MAIZE/36-201:0.39623):0.07060,ABP1_ARATH/33-198:0.17683);
ATP  (P93271_MALDO/24-193,(ABP1_TOBAC/19-187,ABP1_MAIZE/36-201),ABP1_ARATH/33-198);
ATL  0.84837
DNO  4
DLN  510
DID  0.668764
DPH  ((P93271_MALDO/24-193:0.14862,ABP1_TOBAC/19-187:0.19265):0.03720,ABP1_ARATH/33-198:0.17979,ABP1_MAIZE/36-201:0.39086);
DTP  ((P93271_MALDO/24-193,ABP1_TOBAC/19-187),ABP1_ARATH/33-198,ABP1_MAIZE/36-201);
DTL  0.94912
RID  0.700978
RPH  (P93271_MALDO/24-193:0.12849,(ABP1_TOBAC/19-187:0.07622,ABP1_MAIZE/36-201:0.39623):0.07060,ABP1_ARATH/33-198:0.17683);
RTP  (P93271_MALDO/24-193,(ABP1_TOBAC/19-187,ABP1_MAIZE/36-201),ABP1_ARATH/33-198);
RTL  0.84837
LNK  ABP1_ARATH/33-198:P33487:X69901
LNK  ABP1_MAIZE/36-201:P13689:X16309
LNK  ABP1_TOBAC/19-187:P33490:X70902
LNK  P93271_MALDO/24-193:P93271:U77952
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  ABP1_MAIZE/36-201
ASQ  AESSCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMG-SSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKD---EL
DSQ  GCCGAGTCGTCCTGCGTGCGAGATAACTCATTGGTGAGAGACATAAGCCAAATGCCGCAAAGCAGCTATGGGATTGAAGGATTGTCACATATAACAGTTGCTGGTGCGCTCAATCATGGGATGAAGGAGGTGGAAGTGTGGCTTCAGACAATAAGTCCAGGTCAAAGGACGCCGATCCACAGGCATTCCTGTGAAGAAGTTTTCACTGTCCTCAAAGGGAAGGGTACGCTCTTGATGGGA---TCAAGCTCACTAAAGTACCCAGGGCAGCCACAGGAAATTCCTTTCTTTCAGAATACCACATTTTCAATCCCTGTAAACGATCCACACCAGGTTTGGAATTCTGACGAGCACGAAGATTTGCAAGTTCTTGTGATCATTTCGAGACCACCTGCTAAGATATTTTTATATGATGATTGGAGCATGCCTCATACAGCCGCGGTACTGAAATTCCCCTTCGTCTGGGATGAGGACTGCTTCGAAGCAGCAAAAGAC---------GAACTC
TRN  10010101100011000
NAM  P93271_MALDO/24-193
ASQ  ASKCSLKGLPIVRNISELPQDNYGRGGLAHTTVAGSLLHGLKEVEVWLQTFAPGSGTPIHRHSCEEVFVVLKGSGTLYLAPSSHGKFPGKPQEFSIFANSTFHIPVNDVHQVRNTNEHEDLQALVTVSRPPVKVFMYQDWFMPHTAAKLRYPYYWDEECLDVEPPPKDEL
DSQ  GCTTCCAAATGCTCACTCAAAGGGTTACCTATAGTAAGAAATATCAGTGAGCTTCCACAGGATAACTATGGAAGGGGTGGTTTGGCGCACACAACTGTTGCTGGTTCGCTCTTGCATGGGTTGAAAGAGGTCGAGGTTTGGCTACAAACATTTGCTCCAGGATCAGGCACACCAATACACAGGCATTCTTGTGAAGAAGTTTTTGTTGTCCTAAAGGGAAGTGGAACTCTCTACCTTGCACCGAGCTCGCACGGGAAGTTCCCTGGAAAGCCACAAGAGTTCTCTATCTTTGCAAATAGCACATTTCACATACCTGTTAACGATGTTCACCAGGTCCGGAATACAAATGAACATGAGGATTTGCAAGCACTTGTCACCGTCTCTCGTCCGCCAGTTAAAGTGTTCATGTATCAGGACTGGTTCATGCCACACACTGCAGCAAAGTTAAGGTACCCCTACTATTGGGATGAAGAATGCCTGGATGTCGAACCACCACCAAAGGATGAGCTA
TRN  10010101100011000
NAM  ABP1_TOBAC/19-187
ASQ  ASQCSINGLPLVRNISELPQENYGRSGLSHTTIAGSVLHGMKEIEVWLQTFAPGSRTPIHRHSCEEIFVVLKGQGILYLTPSSHSKYPGNPQEFHIFPNSTFHIPVNDVHQVWNTGEHEDLQVLVVISRPPVKVFMYDDWSMPHTAAKLKFPYYWDEECYQTTSW-KDEL
DSQ  GCTTCTCAATGCTCAATTAACGGATTACCACTTGTGAGGAATATCAGCGAGCTTCCACAGGAAAACTATGGGAGGTCCGGTTTATCTCACACTACAATTGCAGGTTCAGTCTTGCACGGCATGAAAGAGATAGAAGTGTGGCTTCAAACATTTGCCCCAGGATCTCGCACACCAATACACAGGCACTCATGTGAAGAAATTTTCGTCGTCTTGAAGGGTCAAGGCATTCTATATCTCACTCCTAGTTCACATTCAAAGTACCCGGGGAACCCGCAGGAGTTCCATATATTCCCTAATAGCACCTTCCATATCCCTGTTAATGATGTTCACCAGGTATGGAACACTGGTGAGCATGAAGATCTACAAGTTTTAGTTGTTATCTCGCGTCCTCCAGTGAAGGTGTTTATGTATGATGACTGGTCGATGCCACACACGGCTGCCAAATTGAAGTTCCCTTATTACTGGGATGAGGAATGTTATCAGACAACTTCGTGG---AAAGATGAGCTT
TRN  10010101110011000
NAM  ABP1_ARATH/33-198
ASQ  GAPCPINGLPIVRNISDLPQDNYGRPGLSHMTVAGSVLHGMKEVEIWLQTFAPGSETPIHRHSCEEVFVVLKGSGTLYLA-ETHGNFPGKPIEFPIFANSTIHIPINDAHQVKNTG-HEDLQVLVIISRPPIKIFIYEDWFMPHTAARLKFPYYWDEQCIQESQK--DEL
DSQ  GGAGCTCCTTGTCCCATCAATGGCTTGCCAATCGTGAGGAATATTAGTGACCTTCCTCAGGATAACTATGGAAGACCAGGTCTTTCCCACATGACTGTTGCTGGCTCCGTATTGCATGGAATGAAAGAGGTTGAAATATGGCTTCAGACATTTGCTCCAGGTTCAGAGACACCAATTCACAGGCACTCCTGTGAAGAGGTTTTTGTTGTCCTAAAGGGCAGTGGTACTCTGTATCTCGCT---GAAACACATGGAAATTTCCCTGGGAAACCAATCGAATTTCCAATCTTTGCCAACAGTACAATTCATATTCCGATCAATGATGCTCATCAGGTCAAAAACACCGGT---CATGAGGACCTGCAGGTGTTGGTTATCATATCTCGGCCGCCTATTAAAATCTTCATCTACGAAGACTGGTTTATGCCACACACTGCTGCAAGGCTGAAGTTCCCTTACTATTGGGATGAGCAATGCATTCAAGAATCACAAAAA------GACGAGCTT
TRN  10010101100011001
//