EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02024 - Leptin)
FAM  PF02024
PID  Leptin
DES  Leptin
IPR  IPR000065
ANO  7
ALN  146
AID  0.85148
APH  ((((OB_PIG/22-167:0.03288,OB_BOVIN/22-167:0.04419):0.00689,OB_CANFA/22-167:0.08712):0.03414,(OB_HUMAN/22-167:0.05350,OB_MACMU/22-167:0.04116):0.02325):0.12091,OB_MOUSE/22-167:0.00000,OB_MELGA/1-145:0.05861);
ATP  ((((OB_PIG/22-167,OB_BOVIN/22-167),OB_CANFA/22-167),(OB_HUMAN/22-167,OB_MACMU/22-167)),OB_MOUSE/22-167,OB_MELGA/1-145);
ATL  0.50309
DNO  7
DLN  438
DID  0.866388
DPH  ((OB_PIG/22-167:0.02842,OB_BOVIN/22-167:0.05644):0.01068,OB_CANFA/22-167:0.05984,((OB_MOUSE/22-167:0.00000,OB_MELGA/1-145:0.03554):0.12659,(OB_HUMAN/22-167:0.02957,OB_MACMU/22-167:0.02548):0.03774):0.01496);
DTP  ((OB_PIG/22-167,OB_BOVIN/22-167),OB_CANFA/22-167,((OB_MOUSE/22-167,OB_MELGA/1-145),(OB_HUMAN/22-167,OB_MACMU/22-167)));
DTL  0.42526
RID  0.85148
RPH  ((((OB_PIG/22-167:0.03288,OB_BOVIN/22-167:0.04419):0.00689,OB_CANFA/22-167:0.08712):0.03414,(OB_HUMAN/22-167:0.05350,OB_MACMU/22-167:0.04116):0.02325):0.12091,OB_MOUSE/22-167:0.00000,OB_MELGA/1-145:0.05861);
RTP  ((((OB_PIG/22-167,OB_BOVIN/22-167),OB_CANFA/22-167),(OB_HUMAN/22-167,OB_MACMU/22-167)),OB_MOUSE/22-167,OB_MELGA/1-145);
RTL  0.50309
LNK  OB_BOVIN/22-167:P50595:U43943
LNK  OB_CANFA/22-167:O02720:AB020986
LNK  OB_HUMAN/22-167:P41159:U18915
LNK  OB_MACMU/22-167:Q28504:U58492
LNK  OB_MELGA/1-145:O93416:AF082501
LNK  OB_MOUSE/22-167:P41160:U18812
LNK  OB_PIG/22-167:Q29406:U63540
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  OB_MACMU/22-167
ASQ  VPIQKVQSDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLTLSQMDQTLAIYQQILINLPSRNVIQISNDLENLRDLLHLLAFSKSCHLPLASGLETLESLGDVLEASLYSTEVVALSRLQGSLQDMLWQLDLSPGC
DSQ  GTGCCCATCCAAAAAGTCCAAAGTGACACCAAAACCCTCATCAAGACAATTGTCACCAGGATCAATGACATTTCACACACGCAGTCGGTCTCCTCCAAACAGAGGGTCACTGGTTTGGACTTCATTCCTGGGCTCCACCCCGTCCTGACCTTATCCCAGATGGACCAGACACTGGCAATCTACCAACAGATCCTCATCAATCTGCCTTCCAGAAACGTGATCCAAATATCCAACGACTTGGAGAATCTCCGGGACCTTCTTCACCTGCTGGCCTTCTCTAAGAGCTGCCATTTGCCCTTGGCCAGTGGCCTGGAGACCTTGGAGAGCCTGGGGGATGTCCTGGAAGCTTCACTCTACTCCACGGAGGTGGTGGCCCTGAGCAGGCTGCAGGGGTCTCTGCAGGACATGCTGTGGCAGCTGGACCTCAGCCCTGGGTGC
TRN  10010101100011000
NAM  OB_HUMAN/22-167
ASQ  VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
DSQ  GTGCCCATCCAAAAAGTCCAAGATGACACCAAAACCCTCATCAAGACAATTGTCACCAGGATCAATGACATTTCACACACGCAGTCAGTCTCCTCCAAACAGAAAGTCACCGGTTTGGACTTCATTCCTGGGCTCCACCCCATCCTGACCTTATCCAAGATGGACCAGACACTGGCAGTCTACCAACAGATCCTCACCAGTATGCCTTCCAGAAACGTGATCCAAATATCCAACGACCTGGAGAACCTCCGGGATCTTCTTCACGTGCTGGCCTTCTCTAAGAGCTGCCACTTGCCCTGGGCCAGTGGCCTGGAGACCTTGGACAGCCTGGGGGGTGTCCTGGAAGCTTCAGGCTACTCCACAGAGGTGGTGGCCCTGAGCAGGCTGCAGGGGTCTCTGCAGGACATGCTGTGGCAGCTGGACCTCAGCCCTGGGTGC
TRN  10010101100011000
NAM  OB_BOVIN/22-167
ASQ  VPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILTSLPSRNVVQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPGC
DSQ  GTGCCCATCCGCAAGGTCCAGGATGACACCAAAACCCTCATTAAGACAATTGTCACCAGGATCAATGACATCTCACACACGCAGTCCGTCTCCTCCAAACAGAGGGTCACTGGTTTGGACTTCATCCCTGGGCTCCACCCTCTCCTGAGTTTGTCCAAGATGGACCAGACATTGGCGATCTACCAACAGATCCTCACCAGTCTGCCTTCCAGAAATGTGGTCCAAATATCCAATGACCTGGAGAACCTCCGGGACCTTCTCCACCTGCTGGCCGCCTCCAAGAGCTGCCCCTTGCCGCAGGTCAGGGCCCTGGAGAGCTTGGAGAGCTTGGGCGTTGTCCTGGAAGCTTCCCTCTACTCCACCGAGGTGGTGGCCCTGAGCCGGCTGCAGGGGTCACTACAGGACATGTTGCGGCAGCTGGACCTCAGTCCCGGGTGC
TRN  10010101100011001
NAM  OB_PIG/22-167
ASQ  VPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
DSQ  GTGCCCATCTGGAGAGTCCAGGATGACACCAAAACCCTCATCAAGACGATTGTCACCAGGATCAGTGACATTTCACACATGCAGTCTGTCTCCTCCAAACAGAGGGTCACCGGTTTGGACTTCATCCCTGGGCTCCATCCTGTCCTGAGTTTGTCCAAGATGGACCAGACCCTGGCGATCTACCAACAGATCCTCACCAGTCTGCCTTCCAGAAATGTGATCCAAATATCGAATGACCTGGAGAACCTCCGGGACCTTCTCCACCTGCTGGCCTCCTCCAAGAGCTGCCCCTTGCCCCAGGCCAGGGCCCTGGAGACCTTGGAGAGCCTGGGCGGCGTCCTGGAAGCCTCCCTCTACTCCACGGAGGTGGTGGCCCTGAGCAGGCTGCAGGGGGCTCTGCAGGACATGCTGCGGCAGCTGGACCTCAGCCCTGGCTGC
TRN  10010101100011001
NAM  OB_CANFA/22-167
ASQ  VPIRKVQDDTKTLIKTIVARINDISHTQSVSSKQRVAGLDFIPGLQPVLSLSRMDQTLAIYQQILNSLHSRNVVQISNDLENLRDLLHLLASSKSCPLPRARGLETFESLGGVLEASLYSTEVVALNRLQAALQDMLRRLDLSPGC
DSQ  GTGCCAATCCGAAAAGTCCAGGATGACACCAAAACCCTCATCAAGACGATTGTCGCCAGGATCAATGACATTTCACACACGCAGTCTGTCTCCTCCAAACAGAGGGTCGCTGGTCTGGACTTCATTCCTGGGCTCCAACCAGTCCTGAGTTTGTCCAGGATGGACCAGACGTTGGCCATCTACCAACAGATCCTCAACAGTCTGCATTCCAGAAATGTGGTCCAAATATCTAATGACCTGGAGAACCTCCGGGACCTTCTCCACCTGCTGGCCTCCTCCAAGAGCTGCCCCTTGCCCCGGGCCAGGGGCCTGGAGACCTTTGAGAGCCTGGGCGGCGTCCTGGAAGCCTCACTCTACTCCACAGAGGTGGTGGCTCTGAACAGACTGCAGGCGGCCCTCCAGGACATGCTTCGGCGGCTGGACCTCAGCCCTGGGTGC
TRN  10010101100011001
NAM  OB_MELGA/1-145
ASQ  VPCQIFQDDTKTLIKTIVTRINDISHTS-VSAKQSVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLHKPESLDGVLEALLYSTEVVALSRLQGSLQDILQQLDISPEC
DSQ  GTGCCGTGTCAGATCTTCCAGGATGACACCAAAACCCTCATCAAGACCATTGTCACCAGGATCAATGACATTTCACACACGTCG---GTATCCGCCAAGCAGAGTGTCACTGGCTTGGACTTCATTCCTGGGCTTCACCCCATTCTGAGTTTGTCCAAGATGGACCAGACTCTGGCAGTCTATCAACAGGTCCTCACCAGCCTGCCTTCCCAAAATGTGCTGCAGATAGCCAATGACCTGGAGAATCTCCGAGACCTCCTCCATCTGCTGGCCTTCTCCAAGAGCTGCTCCCTGCCTCAGACCAGTGGCCTGCACAAGCCAGAGAGCCTGGATGGCGTCCTGGAAGCCTTACTCTACTCCACAGAGGTGGTGGCTTTGAGCAGGCTGCAAGGCTCTCTGCAGGACATTCTTCAACAGTTGGATATTAGCCCGGAATGC
TRN  10010101100011000
NAM  OB_MOUSE/22-167
ASQ  VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
DSQ  GTGCCTATCCAGAAAGTCCAGGATGACACCAAAACCCTCATCAAGACCATTGTCACCAGGATCAATGACATTTCACACACGCAGTCGGTATCCGCCAAGCAGAGGGTCACTGGCTTGGACTTCATTCCTGGGCTTCACCCCATTCTGAGTTTGTCCAAGATGGACCAGACTCTGGCAGTCTATCAACAGGTCCTCACCAGCCTGCCTTCCCAAAATGTGCTGCAGATAGCCAATGACCTGGAGAATCTCCGAGACCTCCTCCATCTGCTGGCCTTCTCCAAGAGCTGCTCCCTGCCTCAGACCAGTGGCCTGCAGAAGCCAGAGAGCCTGGATGGCGTCCTGGAAGCCTCACTCTACTCCACAGAGGTGGTGGCTTTGAGCAGGCTGCAGGGCTCTCTGCAGGACATTCTTCAACAGTTGGATGTTAGCCCTGAATGC
TRN  10010101100011001
//