EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF02008 - zf-CXXC)
FAM  PF02008
PID  zf-CXXC
DES  CXXC zinc finger
IPR  IPR002857
ANO  14
ALN  50
AID  0.424702
APH  (((((Q9U1S4_CAEEL/137-184:1.65956,((HRX_HUMAN/1147-1194:0.17654,MLL4_HUMAN/959-1005:0.32000):0.14213,MBD1_MOUSE/348-395:0.80894):0.00000):0.15097,MBD1_HUMAN/217-262:0.62664):0.06742,Q9U1S4_CAEEL/79-125:0.34131):0.33576,(((DNMT1_MOUSE/648-694:0.07521,P79922_XENLA/518-564:0.22972):0.17985,DNMT1_PARLI/625-671:0.28571):0.12140,((MBD1_MOUSE/186-233:1.62451,Q9VZX2_DROME/646-686:0.00859):0.59563,Q9W352_DROME/178-218:0.88518):0.07704):0.09558):0.32121,Q9VHH9_DROME/670-716:0.19918,Q9UF75_HUMAN/477-523:0.22979);
ATP  (((((Q9U1S4_CAEEL/137-184,((HRX_HUMAN/1147-1194,MLL4_HUMAN/959-1005),MBD1_MOUSE/348-395)),MBD1_HUMAN/217-262),Q9U1S4_CAEEL/79-125),(((DNMT1_MOUSE/648-694,P79922_XENLA/518-564),DNMT1_PARLI/625-671),((MBD1_MOUSE/186-233,Q9VZX2_DROME/646-686),Q9W352_DROME/178-218))),Q9VHH9_DROME/670-716,Q9UF75_HUMAN/477-523);
ATL  9.58857
DNO  14
DLN  150
DID  0.482718
DPH  ((Q9VHH9_DROME/670-716:0.21508,Q9UF75_HUMAN/477-523:0.24385):0.22726,(((DNMT1_MOUSE/648-694:0.14477,P79922_XENLA/518-564:0.16069):0.02984,(DNMT1_PARLI/625-671:0.19432,Q9U1S4_CAEEL/137-184:0.89777):0.18293):0.15611,Q9W352_DROME/178-218:0.46385):0.00000,(((MBD1_MOUSE/186-233:0.52493,Q9VZX2_DROME/646-686:0.22667):0.17944,MBD1_HUMAN/217-262:0.28874):0.20505,((HRX_HUMAN/1147-1194:0.27591,(MLL4_HUMAN/959-1005:0.11222,MBD1_MOUSE/348-395:0.49488):0.14253):0.12625,Q9U1S4_CAEEL/79-125:0.37564):0.03883):0.21583);
DTP  ((Q9VHH9_DROME/670-716,Q9UF75_HUMAN/477-523),(((DNMT1_MOUSE/648-694,P79922_XENLA/518-564),(DNMT1_PARLI/625-671,Q9U1S4_CAEEL/137-184)),Q9W352_DROME/178-218),(((MBD1_MOUSE/186-233,Q9VZX2_DROME/646-686),MBD1_HUMAN/217-262),((HRX_HUMAN/1147-1194,(MLL4_HUMAN/959-1005,MBD1_MOUSE/348-395)),Q9U1S4_CAEEL/79-125)));
DTL  6.12339
RID  0.424702
RPH  (((((Q9U1S4_CAEEL/137-184:1.65956,((HRX_HUMAN/1147-1194:0.17654,MLL4_HUMAN/959-1005:0.32000):0.14213,MBD1_MOUSE/348-395:0.80894):0.00000):0.15097,MBD1_HUMAN/217-262:0.62664):0.06742,Q9U1S4_CAEEL/79-125:0.34131):0.33576,(((DNMT1_MOUSE/648-694:0.07521,P79922_XENLA/518-564:0.22972):0.17985,DNMT1_PARLI/625-671:0.28571):0.12140,((MBD1_MOUSE/186-233:1.62451,Q9VZX2_DROME/646-686:0.00859):0.59563,Q9W352_DROME/178-218:0.88518):0.07704):0.09558):0.32121,Q9VHH9_DROME/670-716:0.19918,Q9UF75_HUMAN/477-523:0.22979);
RTP  (((((Q9U1S4_CAEEL/137-184,((HRX_HUMAN/1147-1194,MLL4_HUMAN/959-1005),MBD1_MOUSE/348-395)),MBD1_HUMAN/217-262),Q9U1S4_CAEEL/79-125),(((DNMT1_MOUSE/648-694,P79922_XENLA/518-564),DNMT1_PARLI/625-671),((MBD1_MOUSE/186-233,Q9VZX2_DROME/646-686),Q9W352_DROME/178-218))),Q9VHH9_DROME/670-716,Q9UF75_HUMAN/477-523);
RTL  9.58857
LNK  DNMT1_MOUSE/648-694:P13864:X14805
LNK  DNMT1_PARLI/625-671:Q27746:Z50183
LNK  HRX_HUMAN/1147-1194:Q03164:D14540
LNK  MBD1_HUMAN/217-262:Q9UIS9:AF120981
LNK  MBD1_MOUSE/186-233:Q9Z2E2:AF072240
LNK  MBD1_MOUSE/348-395:Q9Z2E2:AF072240
LNK  MLL4_HUMAN/959-1005:Q9UMN6:AJ007041
LNK  P79922_XENLA/518-564:P79922:D78638
LNK  Q9U1S4_CAEEL/137-184:Q9U1S4:AL033514
LNK  Q9U1S4_CAEEL/79-125:Q9U1S4:AL033514
LNK  Q9UF75_HUMAN/477-523:Q9UF75:AL133572
LNK  Q9VHH9_DROME/670-716:Q9VHH9:AE003681
LNK  Q9VZX2_DROME/646-686:Q9VZX2:AE003476
LNK  Q9W352_DROME/178-218:Q9W352:AE003446
AMK  xxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9U1S4_CAEEL/137-184
ASQ  APTFKARVgCNACEDCRMQ-DCQICLVCLDKRFFENRHIPGA-MCAKKRC
DSQ  GCTCCAACATTCAAAGCTCGTGTCggtTGTAATGCATGTGAGGATTGTCGAATGCAA---GACTGCCAAATTTGTTTAGTATGTTTGGATAAAAGGTTTTTCGAAAACCGACACATCCCCGGAGCA---ATGTGCGCCAAGAAACGTTGC
TRN  10110101110011010
NAM  Q9W352_DROME/178-218
ASQ  REPKMGKR.CGTCEGCRRP-NCNQCDACRVRV------GHKP-RCIFRTC
DSQ  CGAGAACCAAAGATGGGCAAACGT...TGTGGTACCTGTGAGGGATGCCGGCGTCCC---AATTGCAACCAGTGCGACGCGTGCCGCGTTCGCGTG------------------GGCCACAAGCCG---CGCTGCATATTCCGCACCTGC
TRN  10010101110011011
NAM  Q9VZX2_DROME/646-686
ASQ  QSKKKRKR.CGECVGCQRKDNCGECAPCR-------NDKSHQ-ICKQRRC
DSQ  CAGTCCAAGAAGAAGCGCAAGCGG...TGCGGCGAATGCGTGGGATGCCAGCGCAAGGACAACTGTGGGGAGTGCGCCCCCTGCCGA---------------------AACGACAAGAGCCACCAG---ATCTGCAAGCAGCGCCGCTGC
TRN  11111111111111111
NAM  Q9U1S4_CAEEL/79-125
ASQ  HRSTTSRR.CGVCRGCQCK-PCGQCTYCQDSPQFGGPGVKKQ-SCIERRC
DSQ  CATAGGTCGACGACATCGCGCAGA...TGTGGAGTGTGTCGTGGTTGCCAGTGTAAG---CCATGTGGTCAGTGCACATATTGTCAGGATTCACCACAGTTTGGAGGTCCTGGTGTTAAGAAACAG---AGTTGTATAGAGAGAAGATGT
TRN  10010101110011001
NAM  MBD1_HUMAN/217-262
ASQ  RIVERSRG.CGVCRGCQTQEDCGHCPICLRPPR---PGLRRQWKCVQRRC
DSQ  CGGATTGTGGAAAGGAGCCGAGGG...TGTGGAGTATGCCGGGGCTGTCAGACCCAAGAGGATTGTGGCCATTGCCCCATCTGCCTTCGCCCTCCCCGC---------CCTGGTCTCAGGCGCCAGTGGAAATGTGTCCAGCGACGTTGC
TRN  10010101110011011
NAM  MBD1_MOUSE/348-395
ASQ  TNQRQNRK.CGACAACLRRMDCGRCDFCCDKPKFGGGNQKRQ-KCRWRQC
DSQ  ACGAACCAGCGGCAGAACCGCAAG...TGTGGGGCCTGTGCAGCCTGCCTACGGCGGATGGACTGTGGCCGCTGCGACTTCTGCTGCGACAAGCCCAAATTCGGGGGTGGCAACCAGAAGCGCCAG---AAGTGTCGTTGGCGCCAGTGC
TRN  11011101111011011
NAM  MLL4_HUMAN/959-1005
ASQ  KKMRMAR-.CGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQ-CCVYRKC
DSQ  AAGAAGATGCGCATGGCTCGA---...TGTGGACACTGTCGGGGCTGCCTACGTGTGCAGGACTGTGGGTCCTGTGTCAACTGCCTAGACAAGCCCAAGTTTGGGGGCCCTAACACCAAGAAGCAG---TGCTGTGTATACCGGAAGTGT
TRN  11011111111111111
NAM  HRX_HUMAN/1147-1194
ASQ  KKGRRSRR.CGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQ-CCKMRKC
DSQ  AAGAAAGGACGTCGATCGAGGCGG...TGTGGGCAGTGTCCCGGCTGCCAGGTGCCTGAGGACTGTGGTGTTTGTACTAATTGCTTAGATAAGCCCAAGTTTGGTGGTCGCAATATAAAGAAGCAG---TGCTGCAAGATGAGAAAATGT
TRN  10010101110011010
NAM  Q9UF75_HUMAN/477-523
ASQ  GARRRRTR.CRKCEACLRT-ECGECHFCKDMKKFGGPGRMKQ-SCIMRQC
DSQ  GGAGCTCGGCGGCGCCGGACGCGA...TGCCGCAAGTGCGAGGCCTGCCTGCGGACC---GAGTGCGGAGAGTGCCACTTCTGCAAGGACATGAAGAAGTTCGGGGGCCCCGGGCGCATGAAGCAG---AGCTGCATCATGCGGCAGTGC
TRN  11011111101111111
NAM  Q9VHH9_DROME/670-716
ASQ  QPRRRRTR.CKNCAACQRS-DCGTCPFCMDMVKFGGPGRAKQ-TCMMRQC
DSQ  CAACCAAGACGTCGCAGGACGCGC...TGCAAGAACTGTGCCGCCTGCCAGCGCTCC---GACTGCGGCACCTGTCCCTTCTGTATGGATATGGTTAAGTTTGGTGGACCTGGTCGGGCCAAGCAA---ACGTGCATGATGCGACAATGT
TRN  10110101110011011
NAM  DNMT1_PARLI/625-671
ASQ  AASERKKR.CGVCEICQAP-DCGKCTACKDMIKFGGSGKAKQ-ACKDRRC
DSQ  GCTGCATCAGAGAGGAAGAAACGA...TGTGGAGTTTGTGAGATATGCCAAGCACCA---GATTGTGGGAAGTGTACAGCATGCAAGGATATGATCAAGTTTGGAGGAAGTGGCAAGGCTAAGCAA---GCCTGTAAAGACAGGAGGTGT
TRN  10010101110011001
NAM  P79922_XENLA/518-564
ASQ  ENGIKRRA.CGVCEVCQQP-DCGQCKACQAMLKFGGAGRTKQ-ACMQRRC
DSQ  GAAAATGGCATCAAGCGCAGGGCT...TGTGGTGTTTGTGAGGTGTGTCAGCAACCA---GACTGTGGCCAGTGCAAAGCTTGCCAGGCTATGTTGAAGTTTGGTGGGGCAGGCCGTACCAAACAA---GCCTGCATGCAGAGAAGGTGT
TRN  10110101110011011
NAM  DNMT1_MOUSE/648-694
ASQ  ENAMKRRR.CGVCEVCQQP-ECGKCKACKDMVKFGGTGRSKQ-ACLKRRC
DSQ  GAGAATGCCATGAAGCGCCGCCGC...TGTGGTGTCTGTGAGGTCTGTCAGCAGCCT---GAGTGTGGGAAGTGCAAGGCGTGCAAAGATATGGTGAAGTTTGGTGGCACTGGACGGAGTAAGCAG---GCTTGCCTCAAGAGGAGGTGT
TRN  10010101110011011
NAM  MBD1_MOUSE/186-233
ASQ  QRMFKRVG.CGDCAACLVKEDCGVCSTCRLQLPSDVASGLYC-KCERRRC
DSQ  CAGAGAATGTTTAAGCGAGTCGGC...TGTGGGGACTGTGCAGCTTGCCTGGTGAAAGAGGACTGTGGGGTGTGCTCCACCTGTCGCCTGCAACTGCCCAGTGATGTGGCCTCAGGGCTTTACTGC---AAGTGTGAGCGGAGACGATGC
TRN  10010101100011001
//