EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01992 - vATP-synt_AC39)
FAM  PF01992
PID  vATP-synt_AC39
DES  ATP synthase (C/AC39) subunit
IPR  IPR002843
ANO  14
ALN  362
AID  0.24705
APH  (VATC_PYRHO/37-367:0.30330,((((VATC_METTH/51-384:0.58406,VATC_METJA/39-379:0.43781):0.16436,NTPC_ENTHR/6-323:1.69387):0.19482,(((VATC_ARCFU/15-340:0.70273,VATC_METMA/28-358:0.58128):0.17084,VATC_HALVO/11-346:0.88012):0.16289,VATC_THETH/7-321:1.35545):0.26753):0.24398,((VA0D_YEAST/13-343:0.38182,VA0D_NEUCR/12-362:0.20019):0.04161,(VA0D_SCHPO/12-339:0.30987,(VA0D_MANSE/12-346:0.29967,VA0D_DICDI/21-353:0.25385):0.14249):0.06717):1.64050):0.41544,VATC_DESSY/35-361:0.29296);
ATP  (VATC_PYRHO/37-367,((((VATC_METTH/51-384,VATC_METJA/39-379),NTPC_ENTHR/6-323),(((VATC_ARCFU/15-340,VATC_METMA/28-358),VATC_HALVO/11-346),VATC_THETH/7-321)),((VA0D_YEAST/13-343,VA0D_NEUCR/12-362),(VA0D_SCHPO/12-339,(VA0D_MANSE/12-346,VA0D_DICDI/21-353)))),VATC_DESSY/35-361);
ATL  11.7886
DNO  12
DLN  1086
DID  0.393315
DPH  (((((((VA0D_MANSE/12-346:0.29308,VA0D_DICDI/21-353:0.29375):0.08054,VA0D_SCHPO/12-339:0.30043):0.13434,VA0D_YEAST/13-343:0.31860):0.19194,VA0D_NEUCR/12-362:0.12222):0.64021,NTPC_ENTHR/6-323:0.97423):0.19477,(VATC_METTH/51-384:0.53618,(VATC_THETH/7-321:0.69862,(VATC_METMA/28-358:0.55023,VATC_ARCFU/15-340:0.40289):0.16311):0.04076):0.07897):0.27541,VATC_PYRHO/37-367:0.44271,VATC_DESSY/35-361:0.16586);
DTP  (((((((VA0D_MANSE/12-346,VA0D_DICDI/21-353),VA0D_SCHPO/12-339),VA0D_YEAST/13-343),VA0D_NEUCR/12-362),NTPC_ENTHR/6-323),(VATC_METTH/51-384,(VATC_THETH/7-321,(VATC_METMA/28-358,VATC_ARCFU/15-340)))),VATC_PYRHO/37-367,VATC_DESSY/35-361);
DTL  6.99395
RID  0.253649
RPH  (((VA0D_YEAST/13-343:0.28283,(((VA0D_DICDI/21-353:0.25483,VA0D_MANSE/12-346:0.29941):0.14586,VA0D_SCHPO/12-339:0.30871):0.10314,VA0D_NEUCR/12-362:0.20159):0.10207):1.49374,(((VATC_METMA/28-358:0.64917,VATC_ARCFU/15-340:0.61703):0.27836,VATC_THETH/7-321:1.31462):0.28012,(NTPC_ENTHR/6-323:1.56821,VATC_METTH/51-384:0.60470):0.22396):0.22170):0.47830,VATC_PYRHO/37-367:0.32064,VATC_DESSY/35-361:0.27497);
RTP  (((VA0D_YEAST/13-343,(((VA0D_DICDI/21-353,VA0D_MANSE/12-346),VA0D_SCHPO/12-339),VA0D_NEUCR/12-362)),(((VATC_METMA/28-358,VATC_ARCFU/15-340),VATC_THETH/7-321),(NTPC_ENTHR/6-323,VATC_METTH/51-384))),VATC_PYRHO/37-367,VATC_DESSY/35-361);
RTL  10.0239
LNK  NTPC_ENTHR/6-323:P43456:D17462
LNK  VA0D_DICDI/21-353:P54641:U13150
LNK  VA0D_MANSE/12-346:Q25531:X98825
LNK  VA0D_NEUCR/12-362:P53659:U36470
LNK  VA0D_SCHPO/12-339:O13753:Z99292
LNK  VA0D_YEAST/13-343:P32366:U22382
LNK  VATC_ARCFU/15-340:O29103:AE001023
LNK  VATC_DESSY/35-361:O06502:U96487
LNK  VATC_HALVO/11-346:Q48330:
LNK  VATC_METJA/39-379:Q57672:
LNK  VATC_METMA/28-358:Q60184:U47274
LNK  VATC_METTH/51-384:O27038:AE000869
LNK  VATC_PYRHO/37-367:O57726:AP000007
LNK  VATC_THETH/7-321:P74902:D63799
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxx..................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VATC_DESSY/35-361
ASQ  YPNARIKAMEAKLLTEQKFNELAESRTLQNFVVNLED.TDYKDYLADVSSY--TVEEVEKALERALAGTYELMFKILPKRSKGFFELLLEGWDVRNIANVVKAKLANEPASDYVV---ELG--TMLPKVKAMAEAKTLEEIL-VILEGTPYEEVYQKLLL.-GEIDVTRFETE---LYRMHYGKLLSYAL....SRKDDERIILEEFVRLSIDRVNILTALRAKK-AGLSAEEIK-PMLIPGGTVK---LDPLLHVDSFDMALAELDSTKYGQVIRDVREEIEKD--..--......LSVLEKALNDHIIERISELERFYPLSIATPLSYVLRREREIRKLRAIAKLIENGVEPERIKELAG
DSQ  TATCCGAACGCCAGAATCAAGGCCATGGAAGCGAAGCTCCTCACAGAGCAGAAGTTCAACGAATTGGCCGAAAGCAGAACCCTCCAGAACTTCGTCGTGAACCTGGAGGAC...ACCGACTACAAAGACTACCTCGCCGACGTTTCGAGCTAC------ACCGTTGAGGAGGTTGAGAAGGCCCTTGAGAGGGCCTTAGCCGGAACTTACGAGCTCATGTTCAAGATACTCCCCAAGCGCTCAAAGGGCTTCTTTGAGCTCCTCCTCGAGGGCTGGGACGTCAGGAACATAGCCAACGTCGTCAAGGCCAAGCTCGCCAACGAGCCCGCGAGCGACTACGTCGTC---------GAGCTCGGA------ACGATGCTTCCCAAGGTCAAGGCGATGGCCGAGGCGAAGACCCTTGAAGAAATCCTC---GTAATCCTCGAGGGAACCCCCTATGAGGAAGTTTACCAGAAGCTCCTGCTC...---GGCGAGATAGACGTTACCCGCTTCGAGACCGAG---------CTCTACAGGATGCACTACGGAAAACTGCTGAGCTATGCCCTC............TCAAGGAAGGACGACGAGAGGATTATCTTAGAGGAGTTCGTAAGGCTCTCGATAGACAGGGTCAACATCCTTACCGCGCTCAGGGCAAAGAAG---GCCGGTCTCTCGGCGGAAGAGATAAAG---CCGATGCTGATTCCGGGCGGAACCGTCAAG---------CTTGACCCGCTCCTGCACGTTGACTCCTTCGACATGGCCTTAGCCGAGCTCGACTCGACCAAGTACGGCCAGGTAATCAGGGACGTCAGGGAGGAAATAGAGAAAGAC------......------..................CTGAGCGTCCTCGAGAAGGCACTCAACGACCACATAATCGAGAGGATTTCAGAGCTCGAGCGCTTCTACCCGCTCAGCATAGCCACGCCGCTGAGCTACGTCCTCAGGAGGGAGAGGGAAATCAGGAAGCTGAGGGCAATAGCCAAGCTGATAGAGAACGGCGTTGAGCCCGAAAGGATAAAGGAGCTCGCGGGT
TRN  10010101100011000
NAM  VATC_PYRHO/37-367
ASQ  YPNARIRAMEARLLTDQRFSELAESKTLQNFVVSLED.TDYSPRLASLQSY--NLYEIERALDLSLVDLVELMIKIMPKRIRGLFEILLEEWDVRNITNVIKAKLSNLPPQDFII---PAG--RMFPKVKAMVESKTMEEIL-VILEGTEYEEPLRKLLL.-KEIDLQAFELE---LYKIYYSKLLKYAS....SRKGEEKLISEEFIKMLIDYRNISIILRAKL-SGMPSEEIK-SLLIPGGMLSRAVLESMLSSEDVMMALGELEGTRYGDALKDVREAVEGGR-..--......IDKVEEALRRYILNRMKELSQFYPLSVAVALTYLLERESEVRKLKAVAKLIEDKAKPEKIKELIG
DSQ  TATCCAAATGCTAGGATAAGAGCTATGGAAGCTAGACTTTTAACCGATCAGAGGTTTTCAGAACTAGCCGAGAGTAAGACTCTTCAAAACTTCGTTGTTAGCTTAGAGGAT...ACTGATTATAGTCCCCGCTTAGCCTCTTTGCAAAGTTAC------AATCTTTATGAGATTGAGAGGGCCCTCGATTTATCCTTAGTTGATTTAGTTGAGTTGATGATTAAAATAATGCCAAAAAGAATTAGGGGCCTCTTCGAAATTCTCCTGGAAGAGTGGGATGTTAGGAATATAACTAATGTTATAAAGGCTAAGCTCTCCAATTTACCTCCTCAAGATTTTATAATC---------CCTGCGGGG------AGAATGTTTCCTAAAGTAAAAGCTATGGTTGAGTCGAAGACAATGGAAGAAATATTA---GTAATATTGGAAGGTACGGAGTATGAAGAACCCTTGAGGAAGCTTTTGCTC...---AAGGAGATAGACCTCCAAGCATTTGAATTGGAG---------CTTTATAAGATCTATTACTCCAAGCTCCTTAAGTATGCAAGC............TCCAGGAAGGGAGAGGAAAAATTGATCTCAGAGGAGTTCATTAAAATGCTCATTGACTACAGGAACATATCAATAATCCTGAGGGCTAAGCTA---TCCGGAATGCCAAGCGAGGAAATAAAA---TCCCTCCTAATCCCAGGAGGGATGCTCTCCAGGGCTGTTTTAGAATCAATGCTAAGTAGCGAGGATGTTATGATGGCCCTGGGCGAGTTAGAAGGAACTAGATATGGTGATGCGTTGAAGGATGTCAGGGAAGCCGTCGAGGGGGGAAGG---......------..................ATAGATAAAGTCGAAGAGGCCCTAAGGAGGTACATCCTAAATAGGATGAAAGAGCTCTCTCAGTTCTATCCATTGAGTGTTGCGGTAGCTTTAACGTATCTTTTGGAAAGGGAAAGTGAAGTAAGGAAGCTAAAAGCAGTAGCAAAGTTGATAGAGGACAAAGCTAAACCTGAGAAGATTAAAGAGCTCATAGGT
TRN  10010101100011000
NAM  VATC_METTH/51-384
ASQ  YPNARVRARIGRLLNEKQLSEILETESMEEFKNYLRGlPDYAKYIDRFP--------IEKALESQLAETYEMVSQIAPASIRDPFRANLKRWDVRNIKSLITAKAAGLSAEETVNLLVPGG--EVYEIIEGLADASSVQEVV-TGLEATEYAGVLEDALS.--GYEETGMLLPIEAALDRKFLEGLIRTVg...SPSDDNTKILHTYFGTMVDISNLKIILRAKA-DGLSYDDISPYIVPHGYQIREWKLKDLMESEDVSGVVSGLEGTDYGQMLSEALSEYTSTG-..S-......VAVFERVLEDNLNRMARNFALKKPFGVGPMIGFLSRKEVEVKNLKVIARSKREPGFPEAMVKEML
DSQ  TACCCTAACGCCAGAGTCAGGGCACGAATAGGACGCCTCCTAAACGAGAAACAGTTATCAGAGATTCTTGAAACCGAGTCCATGGAGGAGTTCAAGAACTACCTCCGGGGGctcCCTGACTACGCCAAATACATTGACAGGTTCCCC------------------------ATTGAGAAGGCCCTTGAGAGTCAGCTCGCAGAGACCTATGAGATGGTATCCCAGATAGCACCCGCATCCATAAGGGACCCCTTCAGGGCAAACCTGAAGAGATGGGATGTGAGGAACATCAAGAGCCTCATAACAGCAAAGGCTGCTGGCCTGAGTGCCGAGGAGACAGTGAACCTCCTTGTCCCGGGAGGT------GAAGTCTATGAGATCATCGAGGGCCTTGCAGACGCTTCAAGTGTTCAGGAGGTTGTA---ACCGGCCTTGAGGCTACAGAGTACGCCGGCGTACTGGAGGATGCCCTATCC...------GGCTACGAGGAGACAGGGATGCTCCTCCCAATAGAGGCAGCCCTTGACAGGAAGTTCCTGGAGGGACTCATAAGGACAGTTgga.........AGTCCATCAGACGACAACACAAAGATACTCCACACATACTTTGGGACCATGGTCGACATATCCAACCTTAAAATAATACTCCGTGCAAAGGCA---GACGGTCTCAGCTATGATGACATAAGCCCATACATAGTACCCCACGGTTACCAGATCAGGGAATGGAAGCTCAAGGACCTCATGGAATCAGAGGATGTCAGTGGAGTTGTAAGCGGCCTTGAGGGTACAGACTACGGTCAGATGCTATCAGAGGCCCTCTCAGAGTACACATCAACGGGT---......TCA---..................GTGGCTGTATTCGAACGCGTCCTTGAGGACAACCTCAACAGGATGGCAAGGAACTTCGCACTCAAGAAGCCCTTCGGTGTCGGGCCAATGATCGGATTCCTCAGCAGGAAGGAGGTTGAGGTGAAGAACCTCAAGGTCATAGCAAGGAGCAAGAGGGAGCCAGGCTTCCCTGAAGCAATGGTTAAGGAGATGTTA
TRN  10010101100011000
NAM  VATC_METJA/39-379
ASQ  YVNARIRSKEAKLFDDAKLNELIESGSLEELVGLLED.TDYGQYVIEVMNELKDPVAVEKALDMYLADLYGLIYRISPDSAKKVLKVFAKKFDIKNIKTLIRAKFVGLSAEETYALLIPLGNI-PVEKLKELAEVKTVEEVV-RGLDGTEYFKILQEELS.--NYDQTSNIIGFELALDKYYLESLRKTI....MTEGKEEDIFREFVGTIIDVENLKVILKGKA-DGLSAEELSKYVTLTGYELADWKLKDLMSAGGIEGVLSGLEGTSYAEVLAEAMEEYEKTKS..--......IYAFEKALDKFVLEKGKKLSTRKPFGVGPIIGLIVSKELEVKNLKAIIKGKIENLKPEEIRSLLI
NAM  VATC_ARCFU/15-340
ASQ  YIVARTKVMKSRLLKPEDFRKLLNMEFDEIVRYIGET.-EYKKEIDELGYKFTGPRLLDHALYANLARTYRKLIEVSFGASKFLIMKYLEKWDVWNIINIIRGKMANVQPEVVDDILVPAG--ERDMDFWKTLLVKDIEEIV-KSFEGTPYYEPLSKIGS.--E----DMSKIEDGLYKVYYRELLKLNP....--SDFAMKLFLDFIKMEIDIRNVKTLLRLKA-EDATPDEIMECTIPGGYELTEEELRKLAAMP-IDEMIKALEGYWFWNDVQIEGKE------..--......VAAVEIEFDKVWIKTISKRASNYPLSILPVLQYIVLKKVEVDNLRVLGWGKYYGLPSEEIERQMV
DSQ  TACATCGTTGCAAGAACGAAGGTTATGAAGAGCAGACTGCTGAAGCCAGAGGACTTCAGGAAACTGCTGAACATGGAGTTTGACGAGATTGTGAGGTATATAGGTGAGACG...---GAGTATAAAAAGGAAATCGACGAGCTCGGCTACAAGTTCACGGGGCCAAGACTGCTCGACCACGCCCTCTACGCAAACCTCGCGAGAACCTACAGAAAGCTCATTGAGGTCTCCTTTGGTGCCTCAAAGTTCCTGATAATGAAGTATCTTGAGAAGTGGGATGTCTGGAACATAATAAACATCATCAGGGGCAAAATGGCAAACGTTCAGCCCGAAGTGGTTGATGACATTCTGGTCCCTGCTGGT------GAGAGGGACATGGACTTCTGGAAGACGTTGCTTGTCAAGGATATCGAAGAAATCGTC---AAGTCCTTTGAGGGGACACCCTACTACGAGCCCCTTTCCAAGATAGGCAGC...------GAA------------GACATGAGCAAAATCGAGGACGGGCTTTACAAGGTTTACTACAGGGAGTTACTAAAGCTAAATCCT............------TCAGACTTTGCAATGAAGCTCTTCCTCGACTTCATCAAGATGGAAATAGACATAAGGAACGTCAAGACGCTGCTGAGGCTGAAGGCG---GAGGATGCGACGCCCGACGAAATAATGGAGTGCACGATTCCCGGTGGTTACGAACTTACCGAAGAAGAACTCAGGAAGCTTGCGGCCATGCCG---ATTGATGAAATGATAAAGGCTCTCGAGGGCTACTGGTTCTGGAATGACGTTCAGATTGAAGGGAAGGAG------------------......------..................GTCGCGGCAGTTGAGATCGAGTTCGACAAGGTCTGGATAAAGACAATCTCCAAGAGGGCCAGCAACTATCCGCTCAGCATTCTGCCGGTTCTGCAGTACATTGTGCTGAAAAAGGTTGAAGTGGACAACCTGAGAGTTCTTGGTTGGGGCAAATACTACGGCTTGCCGAGCGAGGAGATTGAGAGGCAGATGGTG
TRN  10010101100011000
NAM  VATC_METMA/28-358
ASQ  YAVTRVRAMKSKLLPKESYPRLLNMGIDEITRFIQES.-EYKNDVDELAMKYSGGDLAEHALNRNLALTYDKLVRITSGELNYLIVAYLKRYDIWNIKTLLRGKIYNASVEDILESLIAAG-EFTYTSMSELAAKATYQEIV-EALKHTEYYPLLQKFDG.------TNLAYIENELDKIYYADLFEAIG....KPRSKDRKLFAQVVRLEVDVKNLINLFRLKKAGVMQPDEIM-PLMIEGGLELK--IEKLAALP-YDEFVNELQRTQYWEAISGVVGPDMIS--..--......LTTLESRLTRYYLESSTILSHVSPITVVPILDYIIHKNNEATNLRIIFRGKETGLSDELIKDQLV
DSQ  TATGCCGTAACCCGTGTCCGCGCGATGAAAAGTAAGTTGCTCCCTAAAGAATCGTATCCCCGGCTTCTCAACATGGGAATCGATGAAATTACCCGCTTTATCCAAGAGTCT...---GAATACAAAAACGACGTTGACGAACTGGCAATGAAATACAGTGGTGGCGACCTGGCAGAACACGCATTGAACAGGAATCTTGCGCTCACTTATGATAAGTTGGTAAGAATTACCTCCGGAGAATTAAATTATCTGATTGTCGCATATCTGAAAAGATACGACATCTGGAACATTAAAACACTTCTCCGTGGGAAAATCTACAACGCATCTGTTGAAGATATCCTGGAATCTCTTATTGCTGCCGGG---GAGTTTACTTACACTTCTATGTCAGAACTTGCAGCCAAGGCCACATATCAGGAAATCGTT---GAGGCCCTGAAACATACTGAGTACTATCCCCTGCTGCAGAAGTTTGACGGA...------------------ACTAACCTAGCATACATAGAAAACGAACTTGACAAGATATATTATGCAGACTTGTTTGAAGCAATCGGG............AAACCAAGATCTAAGGACCGTAAGCTTTTCGCTCAGGTTGTCAGATTGGAAGTAGACGTTAAGAATCTAATCAACCTGTTCAGGCTGAAAAAAGCAGGTGTTATGCAGCCTGATGAAATCATG---CCTCTCATGATTGAAGGTGGTCTCGAGCTAAAG------ATCGAGAAACTGGCAGCTCTACCA---TATGACGAATTTGTCAATGAGCTTCAAAGAACTCAATACTGGGAAGCGATTTCAGGCGTTGTAGGTCCGGATATGATTTCT------......------..................CTGACTACCCTTGAAAGCAGGCTCACTAGATATTATCTTGAATCTTCAACAATTCTTTCGCATGTATCTCCGATCACAGTTGTACCTATTCTGGACTATATCATTCATAAAAATAATGAGGCTACAAATCTCCGGATCATTTTCAGGGGTAAAGAGACTGGCCTCAGTGATGAGTTAATCAAAGACCAGTTGGTG
TRN  10010101100011000
NAM  VATC_HALVO/11-346
ASQ  YVIARVRARRSALFGDEEYRKLVRMGPAEIARFMEES.-EYEAEVNALGSRFSGVDLIEYALNQNLAKQFNDILDWADGRLYDLIARYLRKFDAWNVKTVIRGLYSGASREEVESDLIRXG-EFDDRLISRLLXAGEIEEVV-SVLSGTIFGDGLAAAYE.--EYEEVGVLVPLENAVDRAFYEQLLDDL....-VVGEEAKQYREFLEAEIDFRNARNALRIAR-SGADLDPVD--YFIEGGTLFR-ATELASLATSPDELVSKIRDSRYGDRLSAALSDLEAADS..--......LIGFERALDAALLEYADTLGYVFPLSVTPIVSYILAKEREVDNIRAIARGREAGLDPDAIEAELV
NAM  VATC_THETH/7-321
ASQ  YLNARVRVRRGTLLKESFFQEALDLSFADFLRLLSET.-VYGGELAGQGLP-----DVDRAVLRTQAKLVGDLPRLVTGEAREAVRLLLLRNDLHNLQALLRAKATGRPFEEVLLLPGTLR-EEVWRQAYEAQDPAGMAQVL--AVPGHPLARALRAVLR.--ET--QDLARVEALLAKRFFEDVAKAAK....---GLDQPALRDYLALEVDAENLRTAFKLQG-SGLAPDAFF----LKGGRFVDR-VRFARLMEGDYAVLDELSGTPFSGLSGVRD--------..--......LKALERGLRCVLLK-EAKKGVQDPLGVGLVLAYVKEREWEAVRLRLLARRAYFGLPRAQVEEEVV
DSQ  TACCTCAACGCCCGGGTGCGGGTGCGGAGGGGGACCCTCCTCAAGGAGAGCTTCTTCCAGGAGGCCCTGGACCTCTCCTTCGCCGACTTCCTCCGCCTCCTCTCGGAGACG...---GTTTACGGCGGGGAGCTTGCGGGGCAGGGCCTTCCC---------------GACGTGGACCGGGCCGTGCTCCGCACCCAGGCCAAGCTGGTCGGGGACCTGCCGCGGCTCGTCACCGGGGAGGCGCGGGAGGCGGTGCGGCTCCTCCTCCTGCGGAACGACCTCCACAACCTCCAGGCCCTCCTCCGGGCCAAGGCCACGGGCCGCCCCTTTGAGGAGGTTCTCCTCCTCCCCGGGACCCTACGG---GAGGAGGTTTGGCGCCAGGCCTACGAGGCCCAGGACCCCGCGGGGATGGCCCAGGTGCTC------GCCGTGCCCGGCCACCCCTTGGCCCGCGCCTTGAGGGCGGTCCTGCGG...------GAGACG------CAGGACCTCGCCCGGGTGGAGGCCCTCCTCGCCAAGCGCTTCTTTGAGGACGTGGCCAAGGCGGCCAAG............---------GGGCTGGACCAGCCCGCTTTGCGGGACTACCTGGCCCTGGAGGTGGACGCGGAGAACCTGCGCACCGCCTTCAAGCTTCAAGGC---TCGGGGTTGGCCCCGGACGCCTTCTTC------------CTCAAGGGGGGGCGGTTCGTGGACCGG---GTCCGGTTCGCCCGGCTCATGGAGGGGGACTACGCCGTATTGGACGAGCTTTCCGGCACCCCCTTTTCCGGGCTTTCCGGGGTTCGGGAC------------------------......------..................CTGAAGGCTTTGGAGCGGGGGCTTCGGTGCGTCCTCCTCAAG---GAGGCGAAGAAGGGGGTGCAGGACCCCTTGGGGGTGGGGCTTGTCCTCGCCTACGTGAAGGAGCGGGAGTGGGAGGCCGTGCGCCTTAGGCTCCTCGCCCGGAGGGCCTACTTCGGCCTTCCCCGCGCCCAGGTGGAGGAGGAGGTGGTG
TRN  10010101100011011
NAM  NTPC_ENTHR/6-323
ASQ  -LNPLIRGRELELISKDTFEQMIQTDSIDSLGEILQS.TIYQPYIYDGFDK-----DFEANLSQERSKLFQWLKESAPEP--EIVWIYTMRYTFHNLKVLTKAEITGQNLDHLYI---HDG----FYSLEVLKDAIHTQVSVELPDSLMDYIREVHEYCE.--ES---TILQGIDVIYDRCFLTEQRRLG....--EQLGYPELLEEIIAFIDLTNITTTARGIL--QHRSAGFMTTVISSSGSIPKDTLLSFVRGE-MASFTQFLLTTDYSELLKQVIHEEQID--..--......LVSLEQLKDDYLSS-FYQVAQTQAFGPLPLLAFLNAKEVESKNLRLLIIGKRNHFSLEQLKERMR
DSQ  ---TTAAATCCCTTGATACGTGGTAGAGAATTAGAGTTGATTTCAAAAGACACGTTTGAGCAAATGATCCAAACCGATTCGATCGATTCACTTGGAGAAATCTTACAATCC...ACGATCTATCAGCCGTATATCTATGACGGCTTTGACAAG---------------GATTTTGAAGCCAATCTCTCTCAGGAACGCAGCAAATTATTCCAGTGGTTGAAAGAATCTGCACCAGAACCA------GAAATCGTTTGGATCTATACGATGCGTTACACTTTCCATAATTTGAAAGTATTGACAAAGGCTGAGATCACAGGGCAAAACCTTGATCACCTTTACATC---------CATGATGGA------------TTTTATTCGCTGGAAGTGTTGAAAGATGCGATTCACACGCAAGTGTCGGTGGAATTGCCAGACAGTCTCATGGATTATATTCGAGAAGTTCATGAATACTGCGAA...------GAATCG---------ACTATTTTACAAGGGATCGATGTGATTTATGACCGTTGTTTTCTAACCGAGCAACGTCGCTTAGGG............------GAACAGCTTGGTTACCCTGAACTATTAGAAGAGATCATTGCTTTTATCGATTTAACGAATATCACCACGACAGCAAGAGGGATCTTG------CAGCATCGTTCTGCAGGTTTTATGACAACAGTTATTTCAAGTTCAGGAAGTATTCCGAAAGACACATTGCTTTCCTTTGTTCGTGGGGAA---ATGGCATCTTTTACTCAGTTTTTACTGACAACAGATTACAGTGAGCTATTAAAGCAAGTCATCCATGAAGAACAGATTGAT------......------..................TTAGTTAGCTTGGAACAATTGAAAGATGATTATTTAAGTTCT---TTTTATCAAGTAGCACAGACACAAGCGTTTGGCCCGTTACCATTACTAGCTTTTTTGAACGCAAAAGAAGTCGAAAGTAAAAATCTGCGCCTTTTGATCATTGGCAAACGAAATCACTTTTCACTGGAACAACTAAAAGAAAGGATGAGA
TRN  10010101100011000
NAM  VA0D_SCHPO/12-339
ASQ  YIEALVRGYESALLEQHIYSNLSQCESLEDFRLQLSS.TDYGGFLANQSKL--TSSIISAKATEKLLDEFDLIRRQADETLSKFMDYITYAYMIDNIMLLLTGTVNGQDTHDLLERCHPLG---WFETLPALCVATNVEELYSVVLIETPLAPYFKDCLS.ADDLDEQHIEIIRNTLYKAYLEDFYNFCK....KIGACTADTMLPILEFEADRRAITITINSFG-TELSKEERA-KMYPSFGRLYPFSTSILARAENAGDVENACSLVKEYSDFFDQNS-------..-Q......-KSLDDHFNEKEVE-LNKLAFLQQFHYGIVYAFLKLREQEIRNLTWIAECISQNQR-DRALNI--
DSQ  TATATCGAGGCGTTAGTTAGAGGTTATGAATCTGCTTTATTAGAACAACATATTTATTCAAATTTATCACAATGCGAGTCTTTAGAAGATTTTCGACTTCAGCTTTCTTCA...ACCGATTACGGTGGGTTCCTTGCTAATCAGTCAAAGTTA------ACAAGTTCAATAATTTCCGCAAAAGCTACTGAGAAGTTGCTCGATGAATTTGATTTAATCAGGCGTCAAGCTGATGAGACACTTTCCAAGTTTATGGATTATATTACATATGCTTACATGATTGATAACATTATGCTTTTATTGACTGGTACTGTGAATGGACAGGACACTCATGATTTGCTTGAGCGTTGTCATCCTCTTGGT---------TGGTTTGAAACCTTGCCAGCTCTTTGTGTTGCAACAAACGTGGAAGAGCTTTATAGCGTTGTATTGATTGAGACCCCTCTTGCTCCTTACTTTAAAGATTGTTTATCA...GCAGATGACTTAGATGAGCAACATATCGAAATCATTCGTAACACACTTTATAAAGCCTATCTCGAGGATTTCTATAACTTTTGTAAG............AAGATTGGCGCTTGCACTGCTGACACAATGCTTCCTATTTTGGAATTTGAGGCCGATCGTCGAGCCATCACTATTACAATTAACTCATTCGGA---ACAGAACTTAGTAAAGAAGAACGTGCC---AAAATGTACCCATCGTTTGGAAGATTATATCCATTCAGTACTTCTATTTTAGCAAGAGCAGAGAATGCAGGTGATGTAGAGAACGCCTGCAGTTTGGTGAAAGAATATTCCGACTTTTTTGATCAAAATTCT---------------------......---CAA..................---AAATCTTTGGACGACCATTTTAATGAAAAAGAAGTGGAA---TTGAATAAACTTGCATTTTTACAACAATTTCATTACGGTATCGTTTATGCGTTTTTAAAGCTTCGTGAACAAGAAATTCGCAATCTTACTTGGATTGCCGAATGCATTAGTCAAAATCAGCGC---GACCGTGCGCTGAACATT------
TRN  10010101100011000
NAM  VA0D_NEUCR/12-362
ASQ  YIEGIVRGYRNSLLTSTNYTNMTQCESIDDLKLQLG-.PAYGDFLASLPPK-PSTSALAAKTTDKLVSEFRYVRANAAGSLAKFMDYLTYGYMIDNVALLITGTLHERDTRELLERCHPLG---WFETMPVLCVATNIEELYNSVMIETPLAPYFKSSLS.LQDLDELNIEIVRNTLYKNYLEDFYHFVNthpdMAGTPTAEVMSELLEFEADRRAINITLNSFG-TELSKADRK-KLYPNFGQLYPEGTLMLSRADDFEGVRLAVEGVADYKSFFDAAGLGGGPSGpgNMggggteGKSLEDMFYQKEME-ISKMAFTRQFTYAIVYAWVKLREQEIRNITWIAECIAQNQK-ERINNYIS
DSQ  TACATTGAGGGTATCGTCCGTGGATACAGGAACAGCCTGTTGACGAGCACCAACTATACCAACATGACGCAATGCGAGTCGATTGATGACCTTAAACTCCAACTCGGA---...CCTGCATACGGCGACTTCCTCGCCTCTCTCCCGCCCAAG---CCTTCGACCTCCGCTCTCGCTGCCAAGACCACCGACAAGCTGGTCTCCGAGTTCCGCTATGTCCGCGCCAACGCGGCCGGCTCCCTGGCCAAGTTCATGGACTACCTCACCTACGGCTACATGATCGACAACGTCGCCCTGCTCATCACGGGCACCCTTCACGAGCGCGACACGCGCGAGCTGCTCGAGCGCTGCCACCCGCTCGGC---------TGGTTCGAGACCATGCCCGTCCTCTGCGTGGCCACCAACATTGAGGAGCTGTACAACAGCGTCATGATCGAGACCCCACTGGCCCCGTACTTTAAGAGCAGCCTGTCG...CTCCAGGACCTGGACGAGCTCAACATCGAGATTGTGCGCAACACGCTTTACAAGAACTACCTCGAGGACTTTTACCACTTCGTCAACacccaccccgatATGGCCGGGACCCCGACTGCCGAGGTGATGTCGGAGTTGCTGGAGTTTGAGGCGGATAGGCGGGCTATCAACATCACTCTTAACTCGTTCGGC---ACCGAGCTGTCCAAGGCGGACCGTAAG---AAGCTCTATCCTAACTTTGGGCAGCTGTACCCGGAGGGGACGCTCATGTTGTCGCGGGCAGATGACTTTGAGGGTGTGAGGCTCGCTGTTGAGGGTGTGGCTGATTACAAGTCGTTCTTCGATGCTGCTGGCCTCGGAGGCGGTCCCAGCGGTcccggtAACATGggcggtggcggaactgagGGCAAGAGTCTGGAGGACATGTTCTACCAGAAGGAGATGGAG---ATCTCCAAGATGGCGTTCACGAGGCAGTTCACCTATGCCATAGTGTATGCGTGGGTCAAGTTGAGAGAGCAGGAAATCCGCAATATCACTTGGATCGCCGAGTGCATAGCGCAGAACCAGAAG---GAGAGGATCAACAACTACATCAGC
TRN  10010101100011011
NAM  VA0D_YEAST/13-343
ASQ  -IEGVVRGYRNGLLSNNQYINLTQCDTLEDLKLQLSS.TDYGNFLSSVSSESLTTSLIQEYASSKLYHEFNYIRDQSSGSTRKFMDYITYGYMIDNVALMITGTIHDRDKGEILQRCHPLG---WFDTLPTLSVATDLESLYETVLVDTPLAPYFKNCFDtAEELDDMNIEIIRNKLYKAYLEDFYNFVT...eEIPEPAKECMQTLLGFEADRRSINIALNSLQ-SSDIDPDLKSDLLPNIGKLYPLATFHLAQAQDFEGVRAALANVYEYRGFLETG--------..--......--NLEDHFYQLEME-LCRDAFTQQFAISTVWAWMKSKEQEVRNITWIAECIAQNQR-ERINNYIS
DSQ  ---ATTGAAGGTGTAGTGAGAGGCTACAGAAATGGGTTGTTATCTAATAACCAATACATCAACTTAACACAATGTGACACGTTGGAAGATCTAAAATTACAATTATCATCA...ACTGATTATGGTAATTTTCTTTCCTCTGTTTCCTCAGAGTCTTTGACCACGTCATTGATTCAAGAATATGCTTCTAGCAAGTTGTACCACGAATTCAACTACATAAGAGACCAATCCAGTGGATCCACGAGAAAGTTCATGGACTATATCACTTATGGTTACATGATCGACAATGTAGCATTGATGATTACAGGTACTATTCATGATCGTGATAAGGGTGAAATTTTACAACGTTGTCATCCGCTAGGT---------TGGTTTGATACTTTGCCTACGTTGAGTGTTGCTACTGATCTTGAATCCCTATACGAAACCGTATTGGTGGATACCCCACTGGCACCTTACTTCAAAAACTGTTTTGACacgGCAGAGGAGCTAGACGATATGAACATTGAAATTATTAGAAATAAGCTGTACAAGGCTTATTTAGAAGACTTTTACAATTTTGTCACT.........gaaGAAATTCCGGAACCTGCTAAAGAATGTATGCAAACATTACTAGGGTTTGAAGCTGACAGAAGAAGTATCAATATTGCACTCAACTCTTTGCAA---AGTTCAGATATTGACCCAGATTTGAAAAGTGACTTGTTACCTAACATAGGTAAGTTGTACCCTCTTGCAACGTTTCACTTGGCGCAAGCCCAAGATTTCGAAGGAGTTAGAGCTGCTTTAGCTAACGTCTATGAGTATAGGGGATTTTTGGAGACTGGT------------------------......------..................------AACTTAGAAGATCACTTTTACCAATTGGAAATGGAA---CTATGTAGAGATGCTTTCACGCAACAATTTGCCATCAGCACTGTTTGGGCCTGGATGAAATCCAAGGAACAAGAAGTTAGGAATATTACCTGGATTGCAGAATGTATCGCACAAAACCAAAGA---GAAAGAATCAACAATTATATTTCC
TRN  10010101100011000
NAM  VA0D_MANSE/12-346
ASQ  YLEGLCRGFKCGILKQSDYLNLVQCETLEDLKLHLQG.TDYGTFLANEPSP-LSVSTIDDKLREKLVIEFQHLRNHSVEPLSTFLDFITYSYMIDNIILLITGTLHQRPISELIPKCHPLG---SFEQMEAIHVAATPAELYNAVLVDTPLAPFFVDCIS.EQDLDEMNIEIIRNTLYKAYLEAFYDFCK....QIGGTTADVMCEILAFEADRRAIIITINSFG-TELSKDDRA-KLYPRCGKLNPDGLAALARADDYEQVKAVAEYYAEYSALFEGAGNNVG---..--......DKTLEDKFFEHEVN-LNVHAFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHR-AKIDNYIP
DSQ  TATCTCGAGGGTCTGTGCCGTGGTTTCAAATGTGGAATCCTGAAACAATCTGATTACTTGAACTTGGTGCAATGTGAAACACTGGAAGATCTTAAACTGCATCTACAAGGC...ACAGACTATGGCACCTTTTTGGCTAATGAGCCGAGCCCA---CTTTCGGTTTCCACAATTGACGATAAGCTTCGTGAGAAGCTCGTCATCGAATTTCAACATTTAAGGAATCATTCTGTGGAGCCTTTGTCCACATTCTTGGACTTTATCACCTACAGCTATATGATTGACAATATCATATTGTTGATTACTGGTACTCTCCATCAGAGACCAATTTCTGAGCTCATTCCAAAATGCCACCCACTGGGC---------TCATTTGAACAGATGGAAGCTATTCATGTCGCTGCTACGCCGGCAGAGCTTTACAATGCGGTACTGGTGGACACACCTCTGGCACCTTTCTTTGTTGACTGCATTAGT...GAGCAGGACTTAGATGAAATGAATATTGAGATCATTCGTAACACCTTGTACAAGGCATACCTGGAAGCATTCTATGATTTCTGCAAG............CAGATTGGTGGTACTACAGCTGATGTGATGTGTGAAATCTTAGCATTTGAAGCTGATCGTCGTGCTATCATCATTACTATCAATTCATTTGGA---ACAGAACTGTCTAAGGATGACCGTGCA---AAGTTGTACCCTCGCTGTGGAAAGTTGAACCCTGATGGTTTGGCTGCTTTGGCTCGTGCTGATGACTATGAACAAGTTAAGGCTGTTGCAGAGTATTATGCTGAGTATTCTGCACTGTTTGAGGGAGCTGGAAACAATGTTGGT---------......------..................GACAAAACATTGGAAGATAAGTTCTTTGAACATGAGGTGAAC---CTGAATGTCCATGCTTTTCTGCAGCAGTTCCATTTTGGAGTGTTCTATTCATACCTTAAGTTGAAAGAGCAGGAATGCCGAAACATTGTATGGATTAGTGAATGTGTTGCCCAGAAGCATCGC---GCCAAAATTGACAACTACATTCCA
TRN  10010101100011000
NAM  VA0D_DICDI/21-353
ASQ  YLEAILRGFKKGILSRADYNNLCQCDNLEDMKMHFIS.TDYGDFLAGEPSP-IHTTTIAEKATGKLVSEFNHIRNQAVEPLSTFMDFISYGYMIDNVVLLITGTLHERDISELVDKCHPLG---LFKSMATLSVVHNVADLYNNVLIDTPLAPYIQGCLS.EEDLDEMNNEIIRNTLYKAYLEDFYNYCK....YLGGQTELIMSDILKFEADRRSINITINSFGATELSKDDRE-KLYPSLGLLYPEGTSKLGKAEDVDQVRGILEVYSTYRNFFSDGVNN-----..--......EKSLEDSFFEHEVH-LNRMAFEDQYGYGVFYAYIKLREQEIRNIVWIAECISQNMK-QKMNQYI-
DSQ  TATTTAGAAGCTATCTTAAGAGGTTTCAAAAAAGGTATCCTCTCAAGAGCCGATTACAATAATTTATGTCAATGCGATAATTTAGAAGATATGAAAATGCATTTCATTTCA...ACAGATTATGGTGATTTCCTTGCAGGTGAACCATCACCA---ATTCATACAACCACCATTGCAGAGAAAGCAACAGGTAAATTAGTAAGTGAATTCAACCACATTAGAAATCAAGCAGTCGAACCACTTTCAACTTTTATGGATTTCATTTCATATGGTTATATGATTGATAACGTCGTTTTATTAATCACTGGTACTCTCCACGAAAGAGATATCTCTGAATTGGTCGATAAATGTCACCCATTAGGT---------TTATTCAAGTCAATGGCCACTCTCTCTGTCGTTCATAATGTCGCTGACCTTTATAATAATGTTTTAATTGATACACCATTAGCACCATACATTCAAGGTTGTTTATCA...GAAGAAGATTTAGATGAAATGAATAATGAAATTATTAGAAATACTTTATATAAAGCTTATTTAGAAGATTTTTACAACTATTGCAAA............TATCTCGGTGGTCAAACTGAATTGATCATGAGTGATATTTTAAAGTTTGAAGCAGATCGTAGATCAATCAATATCACAATCAATAGTTTTGGCGCAACTGAACTCTCAAAGGATGATCGTGAA---AAACTTTACCCATCCTTAGGTCTTCTATACCCAGAAGGTACTAGCAAACTTGGTAAAGCTGAAGACGTTGATCAAGTTAGAGGTATCCTCGAAGTTTACTCTACCTATCGTAATTTCTTCTCTGATGGTGTCAACAAC---------------......------..................GAGAAATCATTGGAAGACTCATTCTTTGAACATGAAGTTCAC---TTAAATCGTATGGCTTTTGAAGATCAATATGGTTATGGTGTCTTTTACGCTTACATTAAATTAAGAGAACAAGAAATTAGAAATATAGTTTGGATTGCTGAATGTATTAGTCAAAATATGAAA---CAAAAAATGAATCAATACATT---
TRN  10010101110011000
//