EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01986 - DUF123)
FAM  PF01986
PID  DUF123
DES  Domain of unknown function DUF123
IPR  IPR002837
ANO  4
ALN  99
AID  0.417127
APH  (O29864_ARCFU/1-91:0.61786,(Y613_METJA/247-343:0.53811,O58363_PYRHO/19-114:0.68408):0.32344,O26737_METTH/21-115:0.36040);
ATP  (O29864_ARCFU/1-91,(Y613_METJA/247-343,O58363_PYRHO/19-114),O26737_METTH/21-115);
ATL  2.52388
DNO  4
DLN  297
DID  0.48095
DPH  ((Y613_METJA/247-343:0.40558,O58363_PYRHO/19-114:0.50681):0.16668,O29864_ARCFU/1-91:0.45098,O26737_METTH/21-115:0.34829);
DTP  ((Y613_METJA/247-343,O58363_PYRHO/19-114),O29864_ARCFU/1-91,O26737_METTH/21-115);
DTL  1.87834
RID  0.417127
RPH  (O29864_ARCFU/1-91:0.61786,(Y613_METJA/247-343:0.53811,O58363_PYRHO/19-114:0.68408):0.32344,O26737_METTH/21-115:0.36040);
RTP  (O29864_ARCFU/1-91,(Y613_METJA/247-343,O58363_PYRHO/19-114),O26737_METTH/21-115);
RTL  2.52388
LNK  O26737_METTH/21-115:O26737:AE000844
LNK  O29864_ARCFU/1-91:O29864:AE001078
LNK  O58363_PYRHO/19-114:O58363:BA000001
LNK  Y613_METJA/247-343:Q58030:U67509
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O26737_METTH/21-115
ASQ  IGSLGTVRFPPGFYVYVGSGFS---SLEARIKRHLSSEKRRRWHIDHFLDGAEVECVLYTTDKRRLECAVSEKLHGEKS-VRGFGCSDCSCKSHLHHFK
DSQ  ATCGGAAGCCTTGGAACCGTGAGGTTCCCTCCAGGCTTCTATGTATATGTTGGTTCCGGCTTCAGC---------TCCCTTGAGGCGAGGATAAAAAGACACCTCAGCTCCGAGAAAAGGAGGAGGTGGCACATAGACCACTTCCTGGACGGTGCAGAGGTTGAATGTGTCCTCTACACAACAGATAAAAGAAGACTTGAGTGTGCAGTTTCAGAGAAGCTCCATGGAGAAAAATCT---GTCAGGGGCTTCGGCTGTTCAGACTGTAGTTGCAAATCACACCTGCATCACTTCAAA
TRN  10010101100011001
NAM  O29864_ARCFU/1-91
ASQ  MGALGVIAFRRGYYYYVGSANS---GVH-RVKRHFSIKKKKRWHID-YIS-AKMEVVGAILSKE-PECGLAQRFESFER-IRGFGCSDCDCESHLFYSP
DSQ  GTGGGAGCGCTGGGGGTCATAGCGTTCAGGAGGGGCTATTACTACTATGTCGGCAGTGCCAATAGC---------GGTGTTCAC---AGAGTAAAGCGGCACTTTTCCATCAAAAAGAAGAAGAGGTGGCACATCGAC---TATATCTCA---GCTAAAATGGAGGTGGTGGGAGCTATACTTTCTAAAGAG---CCGGAATGCGGGCTTGCACAAAGGTTCGAGAGTTTTGAAAGA---ATTAGGGGATTCGGATGCTCCGACTGCGATTGCGAATCCCACCTCTTCTACTCCCCA
TRN  10010101100011001
NAM  Y613_METJA/247-343
ASQ  KFGKTERFFKKGYYFYIGSAFGNSMNLKNRIERHLKDDKKMHWHIDYLLKYGKIEEIYIT--NERVECEVANEFIKKFDFVENFGCSDCKCKSHLFYLK
DSQ  AAATTTGGAAAAACAGAGAGATTTTTTAAAAAAGGATATTATTTCTACATTGGCTCTGCCTTTGGAAATTCAATGAACTTAAAAAATAGGATAGAGAGGCATTTAAAGGATGATAAAAAGATGCACTGGCATATTGATTATTTATTAAAATATGGTAAGATTGAAGAGATTTATATTACA------AATGAGAGAGTTGAGTGTGAGGTTGCAAATGAATTTATAAAAAAATTTGATTTTGTTGAGAACTTTGGATGTTCTGATTGTAAATGTAAGAGTCATTTATTTTATTTGAAA
TRN  10010101110011000
NAM  O58363_PYRHO/19-114
ASQ  RTKAREFELTRGYYVYVGSGMN---SLEKRVLRHFSRRKKLHWHIDYLLEKAILLRAYLIPSNERLEERISLEIGKYGTPVEGFGSSDLKVKSNLYRFN
DSQ  AGGACTAAAGCTAGAGAATTTGAGCTTACGAGAGGATATTACGTCTACGTGGGTTCCGGAATGAAT---------TCCCTTGAAAAAAGAGTTCTGAGGCACTTCAGCAGAAGGAAAAAACTTCATTGGCATATAGACTACTTACTTGAGAAAGCTATTCTCCTCAGGGCTTATCTCATACCTAGCAATGAAAGACTCGAGGAGAGGATCTCCTTGGAGATAGGAAAGTATGGAACTCCAGTCGAAGGGTTTGGATCCAGCGATTTAAAAGTGAAGAGTAACCTTTACAGGTTTAAC
TRN  10010101100011010
//