EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01956 - DUF106)
FAM  PF01956
PID  DUF106
DES  Integral membrane protein DUF106
IPR  IPR002809
ANO  4
ALN  214
AID  0.319733
APH  (Y480_METJA/5-198:0.46789,(O59444_PYRHO/1-175:0.75428,O28378_ARCFU/10-220:1.27528):0.35522,O26136_METTH/2-185:0.46124);
ATP  (Y480_METJA/5-198,(O59444_PYRHO/1-175,O28378_ARCFU/10-220),O26136_METTH/2-185);
ATL  3.31391
DNO  4
DLN  642
DID  0.448572
DPH  (Y480_METJA/5-198:25.23364,(O59444_PYRHO/1-175:33.26153,O28378_ARCFU/10-220:39.97695):5.71362,O26136_METTH/2-185:22.67887);
DTP  (Y480_METJA/5-198,(O59444_PYRHO/1-175,O28378_ARCFU/10-220),O26136_METTH/2-185);
DTL  126.834
RID  0.319733
RPH  (Y480_METJA/5-198:0.46789,(O59444_PYRHO/1-175:0.75428,O28378_ARCFU/10-220:1.27528):0.35522,O26136_METTH/2-185:0.46124);
RTP  (Y480_METJA/5-198,(O59444_PYRHO/1-175,O28378_ARCFU/10-220),O26136_METTH/2-185);
RTL  3.31391
LNK  O26136_METTH/2-185:O26136:AE000796
LNK  O28378_ARCFU/10-220:O28378:AE000971
LNK  O59444_PYRHO/1-175:O59444:BA000001
LNK  Y480_METJA/5-198:Q57904:U67498
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O26136_METTH/2-185
ASQ  VLEIVYGALNAVFGPFIAMDP-----------NPQNPILTVFLISAIVAFVITLANKLLVDQERLEELKVEMQEFQQEMMEARKKNDMAALEEIQKKQMEFMDKQREMMTMSFK-PMIVTFIPIILVFYWM------G---QE--PHIVNTLVILPQIAYYVLLVPLWH----MFY-GMPPNAPSYAIG--WLGWYILCSFAMSQIFRKFMGLK
DSQ  GTGCTTGAAATTGTTTACGGGGCGCTGAATGCTGTTTTCGGCCCATTCATTGCAATGGACCCG---------------------------------AATCCACAGAACCCCATCTTAACGGTTTTCCTGATATCGGCCATCGTGGCCTTCGTAATAACCCTGGCCAACAAGCTCCTTGTGGACCAGGAGAGGCTGGAGGAACTCAAGGTTGAGATGCAGGAATTCCAGCAGGAAATGATGGAGGCAAGGAAGAAGAATGACATGGCTGCACTGGAGGAGATCCAGAAGAAACAGATGGAGTTCATGGATAAGCAGCGCGAAATGATGACCATGTCATTCAAG---CCGATGATAGTCACATTCATACCAATAATCCTTGTCTTCTACTGGATG------------------GGA---------CAGGAG------CCACACATAGTCAATACACTGGTCATATTACCCCAGATTGCATACTACGTCCTCCTTGTCCCCCTGTGGCAC------------ATGTTCTAT---GGCATGCCACCAAACGCCCCATCCTATGCCATAGGA------TGGCTCGGATGGTACATATTATGCTCCTTTGCCATGTCCCAGATATTCAGGAAATTCATGGGACTTAAA
TRN  10010101100011000
NAM  Y480_METJA/5-198
ASQ  IFDIYYKTLDAIFMPIIKV---------------LHPALAILIIAIIVSLIINIATKLLVDQKRVAELKKEIQEFQVKFKKMSKNPEM--MEKLQEEQQRIMQLNAELMKMSFR-PMIYTWVPIILIFIYLRHVYGFGGVYQELNPGWNGVVVYLPIILSKILFIDFWHWLGSIFYKGGFKIVSNTALG--WLGWYILCSFATSTVLRKILGIK
DSQ  ATATTTGACATATATTATAAAACCTTGGATGCAATTTTCATGCCTATAATAAAAGTT---------------------------------------------CTACATCCCGCTTTAGCAATTTTAATTATTGCAATAATTGTCTCTTTAATCATAAATATAGCTACAAAACTTTTAGTTGACCAGAAGAGAGTTGCTGAACTAAAAAAGGAGATTCAGGAATTTCAGGTTAAATTTAAAAAAATGTCTAAAAATCCTGAAATG------ATGGAAAAACTTCAAGAAGAACAACAGAGAATTATGCAACTCAACGCTGAATTAATGAAGATGAGTTTTAGG---CCGATGATATATACATGGGTTCCAATAATTTTAATATTTATTTATTTGAGGCATGTTTATGGGTTTGGTGGAGTTTATCAAGAGTTAAATCCTGGTTGGAATGGAGTTGTTGTGTATCTACCTATAATATTGTCAAAGATTTTGTTTATTGATTTCTGGCACTGGCTTGGTTCAATATTTTATAAAGGAGGATTTAAAATAGTTTCTAACACTGCCTTAGGT------TGGTTAGGTTGGTATATTCTCTGTTCATTCGCAACATCTACTGTATTGAGAAAGATACTTGGAATAAAA
TRN  10010101110011000
NAM  O59444_PYRHO/1-175
ASQ  MLEGIYLALDKMFGPMLRN---------------THPMWVVTVSGVILGAFFVLLNYFLVDQEKMKRLQKMAKELQEEFKKARESGDEKKLRKLQQKQLELLRLQNELMKDAFLKPMLITWPIIIIFWGWLKR----W--------YFETAIVKYPFN---FFLFDIFH----KMY---HSALKPDELG--YFGWYFLTSYVVGTILRKVLDMA
DSQ  ATGCTTGAAGGTATATACCTTGCACTCGATAAGATGTTTGGACCAATGCTCAGGAAC---------------------------------------------ACTCATCCCATGTGGGTAGTCACGGTATCTGGGGTGATTTTAGGAGCTTTCTTCGTTTTGCTTAATTACTTCTTGGTTGACCAGGAAAAGATGAAGAGACTTCAAAAGATGGCGAAAGAGCTCCAGGAGGAGTTTAAAAAGGCTAGGGAGAGTGGTGATGAGAAGAAGTTGAGAAAGTTGCAACAGAAGCAACTTGAGTTGCTAAGACTTCAAAATGAATTAATGAAGGATGCATTCCTCAAGCCTATGCTAATAACCTGGCCGATAATAATAATATTTTGGGGTTGGCTGAAGAGA------------TGG------------------------TATTTTGAAACAGCCATAGTAAAGTATCCATTCAAC---------TTCTTCCTGTTCGATATATTTCAC------------AAGATGTAT---------CACTCAGCGCTAAAGCCGGATGAACTGGGA------TACTTTGGCTGGTACTTCCTAACTAGTTACGTTGTAGGTACCATATTAAGGAAAGTCTTAGACATGGCA
TRN  10010101100011000
NAM  O28378_ARCFU/10-220
ASQ  MVLGALFFIGILFSREFRLELGQIVESVLFFLSPYPFHVVILIMSILTGIYSNLIQKFTIDYKRMKEIQKILREYQKEYIEATKQNNKFKLKQLEQKKNEIQQIQSEMMSMQFK-PMFYTFVVTIPIFAWLWEKASASYELVTGATNYGNLTSELPEVFLQTLKPELYT--VVAPFAGQIHVVTPVLIFPWWLFWYLLCSITFGQIIKKVLRVG
DSQ  ATGGTTCTTGGAGCTTTATTTTTCATTGGCATACTCTTCAGCAGGGAGTTCAGGCTGGAGCTTGGACAGATTGTAGAGTCCGTTCTGTTTTTTCTCTCTCCTTATCCCTTCCACGTTGTTATCTTGATCATGTCAATCCTCACTGGAATTTACTCAAATCTCATTCAGAAGTTTACTATCGATTACAAGAGAATGAAGGAGATACAGAAAATTCTGCGCGAGTATCAGAAAGAGTACATAGAGGCAACAAAGCAGAACAACAAATTCAAGCTGAAGCAGCTTGAGCAGAAAAAGAACGAAATCCAGCAGATTCAGAGCGAGATGATGTCAATGCAGTTCAAG---CCGATGTTCTACACCTTTGTAGTCACGATTCCCATTTTTGCGTGGCTATGGGAGAAAGCCTCTGCCAGCTACGAGCTTGTGACGGGAGCAACAAATTACGGAAATCTGACATCAGAGTTGCCCGAGGTTTTCCTGCAAACTCTAAAACCGGAGCTTTACACT------GTTGTGGCACCTTTTGCGGGGCAGATACACGTCGTAACCCCCGTTCTGATTTTCCCATGGTGGCTTTTCTGGTATCTGCTGTGCTCCATAACCTTCGGTCAGATAATAAAGAAAGTTCTGAGGGTAGGG
TRN  10010101100011000
//