EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01920 - KE2)
FAM  PF01920
PID  KE2
DES  KE2 family protein
IPR  IPR002777
ANO  62
ALN  111
AID  0.206871
APH  (((((((((PFDB_METJA/8-112:0.18924,Q6M0M5_METMP/8-112:0.25629):0.15955,((PFDB_THEVO/11-117:0.19318,Q6L0A9_PICTO/11-117:0.42364):0.62852,(((PFDB_PYRHO/9-114:0.52752,PFDB_METMA/10-115:0.38770):0.10385,PFDB_METTH/8-113:0.42154):0.14532,PFDB_ARCFU/9-114:0.35333):0.04378):0.04027):0.14535,(PFDB_HALN1/10-115:0.68820,PFDB_METKA/6-111:0.28829):0.00896):0.14410,((PFDB_PYRAE/9-114:0.66958,(PFDB_SULTO/10-115:0.16378,PFDB_SULSO/10-115:0.20100):0.32581):0.16227,PFDB_AERPE/10-115:1.03074):0.00000):0.14842,(Q94AF7_ARATH/11-116:0.74889,((((PFD1_SCHPO/6-111:0.76220,Q9P3P3_NEUCR/13-118:0.55325):0.14454,Q757Z9_ASHGO/9-112:0.78470):0.24379,PFD1_CAEEL/11-116:0.91736):0.04301,(PFD1_HUMAN/14-119:0.48430,(Q7Q0Q5_ANOGA/3-108:0.41027,Q9VMH8_DROME/13-118:0.33430):0.52564):0.13224):0.19226):1.08738):0.11963,((Q8I3Y6_PLAF7/7-105:1.35153,((Q9N6L6_LEIMA/16-121:0.83088,((((Q8GYJ1_ARATH/14-119:0.09190,Q6K3S8_ORYSA/22-128:0.26009):0.52236,PFD6_CAEEL/8-113:0.54782):0.17852,(PFD6_HUMAN/10-115:0.19068,Q7SX94_BRARE/10-115:0.10997):0.14877):0.09306,(Q7Q034_ANOGA/13-118:0.51099,Q6XHQ2_DROYA/13-118:0.40377):0.20436):0.15516):0.09025,(PFD6_YEAST/2-107:0.39562,(PFD6_SCHPO/2-107:0.48845,Q7S0H5_NEUCR/10-115:0.47276):0.18964):0.21759):0.02877):0.50132,((((Q7SF61_NEUCR/12-117:0.26024,(PFD2_SCHPO/9-114:0.24142,(PFD2_YEAST/18-123:0.27529,Q75AC1_ASHGO/19-124:0.14544):0.63147):0.26560):0.47621,PFD2_ARATH/17-122:0.55669):0.12770,((PFD2_CAEEL/18-123:0.79823,Q9NEG6_LEIMA/15-120:0.74153):0.16164,(PFD2_MOUSE/24-129:0.24474,(Q7Q629_ANOGA/13-118:0.30881,PFD2_DROME/13-118:0.22469):0.31388):0.11707):0.06328):0.34485,Q8ILS7_PLAF7/18-118:0.68859):0.82580):0.35463):0.44520,(Q7QQY6_GIALA/22-128:0.92247,(PFD4_SCHPO/11-119:0.82269,((((Q8X061_NEUCR/25-131:0.21131,Q6UNN7_9HYPO/29-134:0.21337):0.41802,((Q7QIM0_ANOGA/9-114:0.40527,Q8MRY9_DROME/26-131:0.39745):0.31759,PFD4_HUMAN/20-126:0.20631):0.33753):0.13270,((Q8LDK1_ARATH/19-123:0.18039,Q9AR47_MAIZE/16-120:0.15508):0.44580,(PFD4_YEAST/19-124:0.40352,Q754N3_ASHGO/35-140:0.18646):0.44672):0.15638):0.14105,(PFD4_CAEEL/12-119:0.71089,(Q8I3A4_PLAF7/20-125:0.26260,Q7RAS5_PLAYO/64-169:0.08955):0.87310):0.17872):0.06726):0.40356):0.74398):1.66063,Q90634_CHICK/80-171:0.22385):0.02721,Q8NCW9_HUMAN/19-110:0.06332,Q8VC86_MOUSE/177-268:0.17700);
ATP  (((((((((PFDB_METJA/8-112,Q6M0M5_METMP/8-112),((PFDB_THEVO/11-117,Q6L0A9_PICTO/11-117),(((PFDB_PYRHO/9-114,PFDB_METMA/10-115),PFDB_METTH/8-113),PFDB_ARCFU/9-114))),(PFDB_HALN1/10-115,PFDB_METKA/6-111)),((PFDB_PYRAE/9-114,(PFDB_SULTO/10-115,PFDB_SULSO/10-115)),PFDB_AERPE/10-115)),(Q94AF7_ARATH/11-116,((((PFD1_SCHPO/6-111,Q9P3P3_NEUCR/13-118),Q757Z9_ASHGO/9-112),PFD1_CAEEL/11-116),(PFD1_HUMAN/14-119,(Q7Q0Q5_ANOGA/3-108,Q9VMH8_DROME/13-118))))),((Q8I3Y6_PLAF7/7-105,((Q9N6L6_LEIMA/16-121,((((Q8GYJ1_ARATH/14-119,Q6K3S8_ORYSA/22-128),PFD6_CAEEL/8-113),(PFD6_HUMAN/10-115,Q7SX94_BRARE/10-115)),(Q7Q034_ANOGA/13-118,Q6XHQ2_DROYA/13-118))),(PFD6_YEAST/2-107,(PFD6_SCHPO/2-107,Q7S0H5_NEUCR/10-115)))),((((Q7SF61_NEUCR/12-117,(PFD2_SCHPO/9-114,(PFD2_YEAST/18-123,Q75AC1_ASHGO/19-124))),PFD2_ARATH/17-122),((PFD2_CAEEL/18-123,Q9NEG6_LEIMA/15-120),(PFD2_MOUSE/24-129,(Q7Q629_ANOGA/13-118,PFD2_DROME/13-118)))),Q8ILS7_PLAF7/18-118))),(Q7QQY6_GIALA/22-128,(PFD4_SCHPO/11-119,((((Q8X061_NEUCR/25-131,Q6UNN7_9HYPO/29-134),((Q7QIM0_ANOGA/9-114,Q8MRY9_DROME/26-131),PFD4_HUMAN/20-126)),((Q8LDK1_ARATH/19-123,Q9AR47_MAIZE/16-120),(PFD4_YEAST/19-124,Q754N3_ASHGO/35-140))),(PFD4_CAEEL/12-119,(Q8I3A4_PLAF7/20-125,Q7RAS5_PLAYO/64-169)))))),Q90634_CHICK/80-171),Q8NCW9_HUMAN/19-110,Q8VC86_MOUSE/177-268);
ATL  43.8355
DNO  62
DLN  333
DID  0.379026
DPH  (((((Q7QQY6_GIALA/22-128:0.70776,(((Q7QIM0_ANOGA/9-114:0.32519,Q8MRY9_DROME/26-131:0.20501):0.05999,PFD4_HUMAN/20-126:0.51686):0.08646,(((Q8LDK1_ARATH/19-123:0.30212,Q9AR47_MAIZE/16-120:0.07497):0.30099,(PFD4_YEAST/19-124:0.34548,Q754N3_ASHGO/35-140:0.24103):0.14097):0.07598,((Q8X061_NEUCR/25-131:0.16826,Q6UNN7_9HYPO/29-134:0.24130):0.18324,((PFD4_CAEEL/12-119:0.42633,(Q8I3A4_PLAF7/20-125:0.15076,Q7RAS5_PLAYO/64-169:0.18529):0.44140):0.18232,PFD4_SCHPO/11-119:0.43618):0.22436):0.08443):0.09173):0.12873):0.24297,((((PFD6_HUMAN/10-115:0.19331,Q7SX94_BRARE/10-115:0.24190):0.18259,((Q9N6L6_LEIMA/16-121:0.46093,PFD6_CAEEL/8-113:0.42877):0.07453,((Q8GYJ1_ARATH/14-119:0.26221,Q6K3S8_ORYSA/22-128:0.17058):0.24913,(Q7Q034_ANOGA/13-118:0.31459,Q6XHQ2_DROYA/13-118:0.30779):0.06207):0.05827):0.06691):0.05663,(Q8I3Y6_PLAF7/7-105:0.95843,((PFD6_YEAST/2-107:0.31445,PFD6_SCHPO/2-107:0.43297):0.16383,Q7S0H5_NEUCR/10-115:0.31650):0.08750):0.10172):0.21161,(PFDB_AERPE/10-115:0.41970,(((((PFDB_PYRHO/9-114:0.31847,PFDB_METMA/10-115:0.41303):0.06755,((((PFDB_METJA/8-112:0.24287,Q6M0M5_METMP/8-112:0.20838):0.10966,(PFDB_PYRAE/9-114:0.44460,(PFDB_SULTO/10-115:0.20602,PFDB_SULSO/10-115:0.19318):0.28352):0.17108):0.08859,(PFDB_THEVO/11-117:0.21655,Q6L0A9_PICTO/11-117:0.30147):0.36816):0.06580,PFDB_METTH/8-113:0.30563):0.07992):0.09285,PFDB_ARCFU/9-114:0.24285):0.09832,(PFDB_HALN1/10-115:0.38009,PFDB_METKA/6-111:0.19991):0.07693):0.06724,((Q757Z9_ASHGO/9-112:0.47670,(PFD1_SCHPO/6-111:0.67365,Q9P3P3_NEUCR/13-118:0.38558):0.08380):0.04014,((PFD1_CAEEL/11-116:0.57241,(Q7Q0Q5_ANOGA/3-108:0.33771,Q9VMH8_DROME/13-118:0.28801):0.20647):0.12219,(PFD1_HUMAN/14-119:0.35900,Q94AF7_ARATH/11-116:0.49799):0.07829):0.15523):0.33095):0.11407):0.12004):0.06800):0.14404,((Q7Q629_ANOGA/13-118:0.19212,PFD2_DROME/13-118:0.25261):0.06195,((((Q8ILS7_PLAF7/18-118:0.63760,(Q7SF61_NEUCR/12-117:0.23694,(PFD2_SCHPO/9-114:0.31007,(PFD2_YEAST/18-123:0.32997,Q75AC1_ASHGO/19-124:0.16766):0.29629):0.16170):0.15986):0.08549,PFD2_ARATH/17-122:0.39180):0.13966,PFD2_CAEEL/18-123:0.51440):0.06933,(PFD2_MOUSE/24-129:0.26889,Q9NEG6_LEIMA/15-120:0.44837):0.05215):0.08468):0.16215):0.80973,Q8VC86_MOUSE/177-268:0.00000):0.12415,Q8NCW9_HUMAN/19-110:0.03295,Q90634_CHICK/80-171:0.28577);
DTP  (((((Q7QQY6_GIALA/22-128,(((Q7QIM0_ANOGA/9-114,Q8MRY9_DROME/26-131),PFD4_HUMAN/20-126),(((Q8LDK1_ARATH/19-123,Q9AR47_MAIZE/16-120),(PFD4_YEAST/19-124,Q754N3_ASHGO/35-140)),((Q8X061_NEUCR/25-131,Q6UNN7_9HYPO/29-134),((PFD4_CAEEL/12-119,(Q8I3A4_PLAF7/20-125,Q7RAS5_PLAYO/64-169)),PFD4_SCHPO/11-119))))),((((PFD6_HUMAN/10-115,Q7SX94_BRARE/10-115),((Q9N6L6_LEIMA/16-121,PFD6_CAEEL/8-113),((Q8GYJ1_ARATH/14-119,Q6K3S8_ORYSA/22-128),(Q7Q034_ANOGA/13-118,Q6XHQ2_DROYA/13-118)))),(Q8I3Y6_PLAF7/7-105,((PFD6_YEAST/2-107,PFD6_SCHPO/2-107),Q7S0H5_NEUCR/10-115))),(PFDB_AERPE/10-115,(((((PFDB_PYRHO/9-114,PFDB_METMA/10-115),((((PFDB_METJA/8-112,Q6M0M5_METMP/8-112),(PFDB_PYRAE/9-114,(PFDB_SULTO/10-115,PFDB_SULSO/10-115))),(PFDB_THEVO/11-117,Q6L0A9_PICTO/11-117)),PFDB_METTH/8-113)),PFDB_ARCFU/9-114),(PFDB_HALN1/10-115,PFDB_METKA/6-111)),((Q757Z9_ASHGO/9-112,(PFD1_SCHPO/6-111,Q9P3P3_NEUCR/13-118)),((PFD1_CAEEL/11-116,(Q7Q0Q5_ANOGA/3-108,Q9VMH8_DROME/13-118)),(PFD1_HUMAN/14-119,Q94AF7_ARATH/11-116))))))),((Q7Q629_ANOGA/13-118,PFD2_DROME/13-118),((((Q8ILS7_PLAF7/18-118,(Q7SF61_NEUCR/12-117,(PFD2_SCHPO/9-114,(PFD2_YEAST/18-123,Q75AC1_ASHGO/19-124)))),PFD2_ARATH/17-122),PFD2_CAEEL/18-123),(PFD2_MOUSE/24-129,Q9NEG6_LEIMA/15-120)))),Q8VC86_MOUSE/177-268),Q8NCW9_HUMAN/19-110,Q90634_CHICK/80-171);
DTL  29.0593
RID  0.206871
RPH  (((((((((PFDB_METJA/8-112:0.18924,Q6M0M5_METMP/8-112:0.25629):0.15955,((PFDB_THEVO/11-117:0.19318,Q6L0A9_PICTO/11-117:0.42364):0.62852,(((PFDB_PYRHO/9-114:0.52752,PFDB_METMA/10-115:0.38770):0.10385,PFDB_METTH/8-113:0.42154):0.14532,PFDB_ARCFU/9-114:0.35333):0.04378):0.04027):0.14535,(PFDB_HALN1/10-115:0.68820,PFDB_METKA/6-111:0.28829):0.00896):0.14410,((PFDB_PYRAE/9-114:0.66958,(PFDB_SULTO/10-115:0.16378,PFDB_SULSO/10-115:0.20100):0.32581):0.16227,PFDB_AERPE/10-115:1.03074):0.00000):0.14842,(Q94AF7_ARATH/11-116:0.74889,((((PFD1_SCHPO/6-111:0.76220,Q9P3P3_NEUCR/13-118:0.55325):0.14454,Q757Z9_ASHGO/9-112:0.78470):0.24379,PFD1_CAEEL/11-116:0.91736):0.04301,(PFD1_HUMAN/14-119:0.48430,(Q7Q0Q5_ANOGA/3-108:0.41027,Q9VMH8_DROME/13-118:0.33430):0.52564):0.13224):0.19226):1.08738):0.11963,((Q8I3Y6_PLAF7/7-105:1.35153,((Q9N6L6_LEIMA/16-121:0.83088,((((Q8GYJ1_ARATH/14-119:0.09190,Q6K3S8_ORYSA/22-128:0.26009):0.52236,PFD6_CAEEL/8-113:0.54782):0.17852,(PFD6_HUMAN/10-115:0.19068,Q7SX94_BRARE/10-115:0.10997):0.14877):0.09306,(Q7Q034_ANOGA/13-118:0.51099,Q6XHQ2_DROYA/13-118:0.40377):0.20436):0.15516):0.09025,(PFD6_YEAST/2-107:0.39562,(PFD6_SCHPO/2-107:0.48845,Q7S0H5_NEUCR/10-115:0.47276):0.18964):0.21759):0.02877):0.50132,((((Q7SF61_NEUCR/12-117:0.26024,(PFD2_SCHPO/9-114:0.24142,(PFD2_YEAST/18-123:0.27529,Q75AC1_ASHGO/19-124:0.14544):0.63147):0.26560):0.47621,PFD2_ARATH/17-122:0.55669):0.12770,((PFD2_CAEEL/18-123:0.79823,Q9NEG6_LEIMA/15-120:0.74153):0.16164,(PFD2_MOUSE/24-129:0.24474,(Q7Q629_ANOGA/13-118:0.30881,PFD2_DROME/13-118:0.22469):0.31388):0.11707):0.06328):0.34485,Q8ILS7_PLAF7/18-118:0.68859):0.82580):0.35463):0.44520,(Q7QQY6_GIALA/22-128:0.92247,(PFD4_SCHPO/11-119:0.82269,((((Q8X061_NEUCR/25-131:0.21131,Q6UNN7_9HYPO/29-134:0.21337):0.41802,((Q7QIM0_ANOGA/9-114:0.40527,Q8MRY9_DROME/26-131:0.39745):0.31759,PFD4_HUMAN/20-126:0.20631):0.33753):0.13270,((Q8LDK1_ARATH/19-123:0.18039,Q9AR47_MAIZE/16-120:0.15508):0.44580,(PFD4_YEAST/19-124:0.40352,Q754N3_ASHGO/35-140:0.18646):0.44672):0.15638):0.14105,(PFD4_CAEEL/12-119:0.71089,(Q8I3A4_PLAF7/20-125:0.26260,Q7RAS5_PLAYO/64-169:0.08955):0.87310):0.17872):0.06726):0.40356):0.74398):1.66063,Q90634_CHICK/80-171:0.22385):0.02721,Q8NCW9_HUMAN/19-110:0.06332,Q8VC86_MOUSE/177-268:0.17700);
RTP  (((((((((PFDB_METJA/8-112,Q6M0M5_METMP/8-112),((PFDB_THEVO/11-117,Q6L0A9_PICTO/11-117),(((PFDB_PYRHO/9-114,PFDB_METMA/10-115),PFDB_METTH/8-113),PFDB_ARCFU/9-114))),(PFDB_HALN1/10-115,PFDB_METKA/6-111)),((PFDB_PYRAE/9-114,(PFDB_SULTO/10-115,PFDB_SULSO/10-115)),PFDB_AERPE/10-115)),(Q94AF7_ARATH/11-116,((((PFD1_SCHPO/6-111,Q9P3P3_NEUCR/13-118),Q757Z9_ASHGO/9-112),PFD1_CAEEL/11-116),(PFD1_HUMAN/14-119,(Q7Q0Q5_ANOGA/3-108,Q9VMH8_DROME/13-118))))),((Q8I3Y6_PLAF7/7-105,((Q9N6L6_LEIMA/16-121,((((Q8GYJ1_ARATH/14-119,Q6K3S8_ORYSA/22-128),PFD6_CAEEL/8-113),(PFD6_HUMAN/10-115,Q7SX94_BRARE/10-115)),(Q7Q034_ANOGA/13-118,Q6XHQ2_DROYA/13-118))),(PFD6_YEAST/2-107,(PFD6_SCHPO/2-107,Q7S0H5_NEUCR/10-115)))),((((Q7SF61_NEUCR/12-117,(PFD2_SCHPO/9-114,(PFD2_YEAST/18-123,Q75AC1_ASHGO/19-124))),PFD2_ARATH/17-122),((PFD2_CAEEL/18-123,Q9NEG6_LEIMA/15-120),(PFD2_MOUSE/24-129,(Q7Q629_ANOGA/13-118,PFD2_DROME/13-118)))),Q8ILS7_PLAF7/18-118))),(Q7QQY6_GIALA/22-128,(PFD4_SCHPO/11-119,((((Q8X061_NEUCR/25-131,Q6UNN7_9HYPO/29-134),((Q7QIM0_ANOGA/9-114,Q8MRY9_DROME/26-131),PFD4_HUMAN/20-126)),((Q8LDK1_ARATH/19-123,Q9AR47_MAIZE/16-120),(PFD4_YEAST/19-124,Q754N3_ASHGO/35-140))),(PFD4_CAEEL/12-119,(Q8I3A4_PLAF7/20-125,Q7RAS5_PLAYO/64-169)))))),Q90634_CHICK/80-171),Q8NCW9_HUMAN/19-110,Q8VC86_MOUSE/177-268);
RTL  43.8355
LNK  PFD1_CAEEL/11-116:Q17827:Z73103
LNK  PFD1_HUMAN/14-119:O60925:BC011869
LNK  PFD1_SCHPO/6-111:O14334:Z98270
LNK  PFD2_ARATH/17-122:Q9LJ98:AP000731
LNK  PFD2_CAEEL/18-123:Q9N5M2:AC006661
LNK  PFD2_DROME/13-118:Q9VTE5:AE003546
LNK  PFD2_MOUSE/24-129:O70591:Y17393
LNK  PFD2_SCHPO/9-114:Q9UTC9:AL133156
LNK  PFD2_YEAST/18-123:P40005:U18530
LNK  PFD4_CAEEL/12-119:Q17435:Z73102
LNK  PFD4_HUMAN/20-126:Q9NQP4:U41816
LNK  PFD4_SCHPO/11-119:Q9UTD4:AL133156
LNK  PFD4_YEAST/19-124:P53900:X92517
LNK  PFD6_CAEEL/8-113:P52554:Z71261
LNK  PFD6_HUMAN/10-115:O15212:Z97184
LNK  PFD6_SCHPO/2-107:O14450:Z99260
LNK  PFD6_YEAST/2-107:P52553:X76563
LNK  PFDB_AERPE/10-115:Q9YC11:AP000061
LNK  PFDB_ARCFU/9-114:O29115:AE001024
LNK  PFDB_HALN1/10-115:Q9HSH0:AE004987
LNK  PFDB_METJA/8-112:Q58394:U67541
LNK  PFDB_METKA/6-111:Q8TYC7:AE010335
LNK  PFDB_METMA/10-115:Q8PZ21:AE013292
LNK  PFDB_METTH/8-113:O26774:AE000848
LNK  PFDB_PYRAE/9-114:Q8ZVN4:AE009862
LNK  PFDB_PYRHO/9-114:O58268:AP000002
LNK  PFDB_SULSO/10-115:Q9UXB8:Y18930
LNK  PFDB_SULTO/10-115:Q975H2:AP000982
LNK  PFDB_THEVO/11-117:Q979C4:AP000995
LNK  Q6K3S8_ORYSA/22-128:Q6K3S8:AP005614
LNK  Q6L0A9_PICTO/11-117:Q6L0A9:AE017261
LNK  Q6M0M5_METMP/8-112:Q6M0M5:BX957219
LNK  Q6UNN7_9HYPO/29-134:Q6UNN7:AY365418
LNK  Q6XHQ2_DROYA/13-118:Q6XHQ2:AY232131
LNK  Q754N3_ASHGO/35-140:Q754N3:AE016819
LNK  Q757Z9_ASHGO/9-112:Q757Z9:AE016818
LNK  Q75AC1_ASHGO/19-124:Q75AC1:AE016817
LNK  Q7Q034_ANOGA/13-118:Q7Q034:AAAB01008986
LNK  Q7Q0Q5_ANOGA/3-108:Q7Q0Q5:AAAB01008980
LNK  Q7Q629_ANOGA/13-118:Q7Q629:AAAB01008960
LNK  Q7QIM0_ANOGA/9-114:Q7QIM0:AAAB01008807
LNK  Q7QQY6_GIALA/22-128:Q7QQY6:AACB01000140
LNK  Q7RAS5_PLAYO/64-169:Q7RAS5:AABL01002174
LNK  Q7S0H5_NEUCR/10-115:Q7S0H5:AABX01000498
LNK  Q7SF61_NEUCR/12-117:Q7SF61:AABX01000023
LNK  Q7SX94_BRARE/10-115:Q7SX94:BC055580
LNK  Q8GYJ1_ARATH/14-119:Q8GYJ1:AK117588
LNK  Q8I3A4_PLAF7/20-125:Q8I3A4:AL929355
LNK  Q8I3Y6_PLAF7/7-105:Q8I3Y6:AL929352
LNK  Q8ILS7_PLAF7/18-118:Q8ILS7:AE014818
LNK  Q8LDK1_ARATH/19-123:Q8LDK1:AY085967
LNK  Q8MRY9_DROME/26-131:Q8MRY9:AY119195
LNK  Q8NCW9_HUMAN/19-110:Q8NCW9:AL834538
LNK  Q8VC86_MOUSE/177-268:Q8VC86:BC021457
LNK  Q8X061_NEUCR/25-131:Q8X061:AL669992
LNK  Q90634_CHICK/80-171:Q90634:U17000
LNK  Q94AF7_ARATH/11-116:Q94AF7:AY048212
LNK  Q9AR47_MAIZE/16-120:Q9AR47:AJ310146
LNK  Q9N6L6_LEIMA/16-121:Q9N6L6:AL354592
LNK  Q9NEG6_LEIMA/15-120:Q9NEG6:AL138618
LNK  Q9P3P3_NEUCR/13-118:Q9P3P3:AL389891
LNK  Q9VMH8_DROME/13-118:Q9VMH8:AE003612
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxx
NAM  PFDB_AERPE/10-115
ASQ  EAKYTKYLKLRETLSVVMREKATVEAGLAEVESVLKELEGLPED...AELYRLTGFVLVKK.SKNEVVEDLNKRKEDLELKLKVLKSQEEHLKKELERIESELRR.LLQGG
DSQ  GAGGCGAAGTACACTAAGTATCTGAAGCTCAGGGAGACCCTGAGCGTGGTTATGAGGGAGAAGGCCACTGTAGAGGCTGGCCTAGCCGAGGTGGAGAGTGTCTTAAAGGAGCTTGAAGGCCTGCCGGAGGAC.........GCCGAGCTCTACAGGCTCACGGGCTTCGTCCTTGTGAAAAAG...AGCAAGAACGAGGTGGTGGAGGACCTCAACAAGAGGAAGGAGGATCTGGAGCTGAAGCTCAAGGTGCTGAAGAGCCAGGAGGAGCATCTGAAGAAGGAGCTCGAGAGGATAGAGTCGGAGCTTAGGAGG...CTCCTGCAGGGAGGG
TRN  10010101100011010
NAM  PFDB_SULSO/10-115
ASQ  QAQLAKFQQLKDQLDRLLLEKSTIENELREINKVLEELSVLNAD...ATIYKIVGNLLVKS.DKTSVEKELNDRKELLELRSRTYQKQESILRKQLEDLQAKIND.MLSKY
DSQ  CAAGCTCAACTAGCTAAGTTTCAACAGTTAAAAGATCAGCTTGATAGATTATTGTTAGAAAAGTCTACCATAGAGAATGAGTTAAGGGAGATAAATAAGGTATTGGAAGAGTTATCCGTTCTCAATGCAGAT.........GCAACCATTTATAAGATTGTTGGGAATCTATTAGTTAAGTCA...GATAAGACATCAGTAGAAAAGGAGCTTAATGATAGGAAGGAATTGTTAGAACTCAGATCGAGGACTTATCAGAAGCAAGAAAGTATTTTAAGAAAGCAACTAGAAGACTTGCAGGCTAAAATAAATGAC...ATGCTATCGAAGTAT
TRN  10010101110011000
NAM  PFDB_SULTO/10-115
ASQ  QTQLVKLQQLQDQLNRLLTEKNVIDSELREVNKILQELSQLPAG...TTVYKIVGNLLVKT.DKETVQKELDDRKEILELRSRTYQKQENLLRTQLEDLQKKVNE.LLAKY
DSQ  CAAACACAATTAGTAAAATTACAACAATTACAAGATCAATTAAATAGACTTCTTACTGAAAAAAATGTAATAGATAGTGAATTAAGAGAAGTAAATAAAATACTTCAAGAGCTCTCTCAATTACCAGCTGGT.........ACGACAGTTTACAAAATAGTTGGAAATTTACTAGTTAAAACA...GATAAAGAAACAGTACAAAAGGAGTTAGATGATAGGAAAGAAATTTTAGAATTAAGATCTAGAACTTATCAGAAACAAGAAAACTTACTGAGAACGCAACTAGAAGATTTGCAGAAAAAAGTAAATGAA...CTACTTGCAAAGTAT
TRN  10010101100011010
NAM  PFDB_PYRAE/9-114
ASQ  QDLVNRFNQAQAQLQNVLLRKQQYEAELKEVEKAISEIERLPQD...AKIFKNVGNFLVPQ.SRDVALQELRDRKELLELHVKTLTRQESMLREQLDKLREEINK.ELAKL
DSQ  CAGGACTTGGTAAATAGGTTTAACCAGGCCCAAGCCCAGTTACAAAACGTGTTGCTTAGAAAACAGCAGTACGAGGCCGAGTTGAAAGAAGTGGAGAAGGCTATTTCTGAAATCGAAAGACTGCCACAAGAC.........GCCAAGATTTTTAAAAACGTGGGCAACTTCCTCGTGCCCCAG...AGCCGCGATGTAGCATTGCAAGAGCTCAGAGATAGGAAGGAATTATTGGAATTGCACGTCAAGACTCTTACGCGACAAGAATCCATGTTGAGAGAACAACTCGACAAACTTCGCGAGGAAATAAACAAA...GAGCTGGCTAAGCTC
TRN  10010101100011010
NAM  Q6M0M5_METMP/8-112
ASQ  QNQLMQFQQLQQQLQMIMYQKQQFETQLKEMEKAIEEMEKSDSE...-EVFKMAGGILVKR.NKAEVKEELSEKIETLQLRVTTFEKQEEKMQKRYTELQESLQK.VMGQG
DSQ  CAAAATCAATTAATGCAATTCCAACAACTCCAGCAGCAGTTACAAATGATAATGTACCAAAAACAGCAGTTTGAAACACAATTAAAGGAAATGGAAAAAGCTATTGAAGAAATGGAAAAATCTGATTCCGAA.........---GAAGTATTTAAGATGGCTGGTGGAATCCTCGTTAAAAGA...AACAAGGCTGAAGTAAAAGAAGAATTAAGTGAAAAGATAGAAACACTCCAGTTAAGAGTAACTACCTTTGAAAAACAAGAAGAAAAAATGCAGAAAAGATACACTGAATTACAAGAAAGCCTCCAAAAA...GTAATGGGTCAGGGC
TRN  10010101110011010
NAM  PFDB_METJA/8-112
ASQ  QAQLMQLQQLQQQLQMILMQKQSVETELKECKKALEELEKSSSD...-EVYKLVGGLFVKR.KKEDVKKELEEKVETLELRVKTLEKQEEKLQSRLKELQEKIQK.MIPTA
DSQ  CAAGCTCAATTGATGCAGTTACAGCAATTACAGCAACAACTACAAATGATTTTAATGCAGAAGCAGAGTGTTGAGACAGAATTAAAAGAATGTAAAAAGGCATTAGAAGAGTTGGAAAAATCTTCAAGTGAT.........---GAAGTTTATAAATTAGTTGGTGGATTGTTTGTTAAAAGA...AAAAAGGAAGATGTCAAAAAAGAACTCGAAGAGAAAGTCGAAACATTAGAGTTGAGAGTAAAAACATTAGAGAAGCAAGAAGAAAAATTACAGTCAAGATTAAAAGAACTTCAAGAAAAGATTCAAAAA...ATGATACCTACAGCA
TRN  10010101110011000
NAM  PFDB_METKA/6-111
ASQ  EQQVAQLQQLQQQLSSIVAQKQQLELQLREIERALKELDEIEED...TKVYKTVGGLLIEA.DRDEVKEELEDRKETLELRVKTLEKQEKRLQQQIENLQKRLQK.ALQQA
DSQ  GAGCAGCAGGTGGCTCAGCTCCAGCAGCTTCAGCAGCAGTTGAGCTCCATCGTCGCGCAAAAGCAGCAGCTGGAGCTGCAGCTTAGGGAGATCGAAAGGGCCCTGAAGGAACTCGACGAAATCGAGGAAGAT.........ACCAAGGTATACAAAACTGTTGGTGGCTTGCTGATAGAAGCT...GACCGTGATGAGGTGAAGGAAGAGCTCGAGGACAGAAAAGAAACACTGGAGCTAAGGGTAAAAACACTAGAGAAGCAAGAAAAACGCCTCCAGCAGCAGATCGAGAACCTCCAGAAGAGGCTCCAGAAG...GCTCTTCAGCAGGCC
TRN  10010101100011011
NAM  PFDB_METTH/8-113
ASQ  QHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADD...AEVYKSSGNILIRV.AKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQE.AMKGA
DSQ  CAGCACCAGTTAGCTCAGTTCCAGCAGCTGCAGCAGCAGGCACAGGCAATATCTGTGCAGAAACAGACGGTTGAAATGCAGATTAATGAGACACAGAAGGCCCTTGAAGAACTCTCAAGGGCTGCCGATGAC.........GCTGAAGTATATAAGAGCTCAGGTAACATTCTCATCAGGGTT...GCCAAGGATGAACTTACAGAGGAACTTCAGGAAAAACTTGAAACACTCCAGCTCAGGGAGAAGACAATTGAGAGACAGGAAGAACGCGTCATGAAGAAACTGCAGGAGATGCAGGTCAACATCCAGGAA...GCAATGAAGGGCGCG
TRN  10010101100011000
NAM  PFDB_ARCFU/9-114
ASQ  QNLVAQLQQLQQQLQAVITQRAQVEALLRDTEQALEELQKVDDE...TPVYKAVGNILVKE.KKEDVIKELTEKKETYEIRIKTLQRQEEKLRERFAETQQKLQN.LLSPQ
DSQ  CAGAATCTGGTTGCGCAGCTTCAGCAGCTTCAGCAGCAGCTGCAGGCAGTAATCACTCAGAGGGCTCAGGTAGAGGCGTTGCTGAGAGACACGGAGCAGGCACTGGAGGAGCTTCAGAAGGTCGATGATGAA.........ACACCGGTCTACAAGGCTGTTGGAAACATTCTGGTTAAGGAG...AAGAAGGAGGACGTGATTAAGGAGCTTACAGAGAAAAAGGAGACCTACGAGATAAGGATAAAGACTCTGCAAAGGCAGGAGGAAAAGCTCAGGGAGAGGTTCGCTGAGACACAGCAGAAGCTCCAGAAC...CTGCTCAGTCCTCAG
TRN  10010101100011011
NAM  PFDB_METMA/10-115
ASQ  QNQIAQLQQVQQQVQALSMQKSQIEAMQKESKMALEELERLADD...AVIYRSVGELVIKT.TKEESVSKLKDREETLSLRLQSISRQEERLTARFKQLQEQIQQ.ALGPR
DSQ  CAGAACCAGATAGCACAGCTTCAGCAGGTACAGCAGCAAGTTCAGGCTCTGTCCATGCAAAAATCTCAGATTGAAGCTATGCAAAAAGAGTCAAAAATGGCTCTTGAGGAATTGGAAAGACTGGCTGACGAT.........GCGGTTATTTACCGCAGTGTCGGAGAGCTGGTTATAAAAACA...ACTAAAGAGGAGTCCGTTTCAAAACTTAAAGACAGAGAAGAAACCCTCTCTCTCAGGCTTCAGTCTATCTCCAGGCAGGAAGAAAGACTTACTGCCCGCTTCAAACAGCTTCAGGAGCAGATCCAGCAG...GCTCTTGGGCCCAGA
TRN  10010101100011001
NAM  PFDB_PYRHO/9-114
ASQ  QAMLGQLDTYQQQLQLVIQQKQKVQADLNEAKKALEEIETLPDD...AQIYKTVGTLIVKT.TKEKAVQELKEKIETLEVRLNALNRQEQKINEKVKELTQKIQA.ALRPP
DSQ  CAGGCGATGCTTGGCCAACTCGATACGTATCAGCAACAGCTTCAACTTGTAATCCAGCAGAAGCAGAAGGTTCAAGCTGACCTAAATGAAGCTAAGAAAGCCCTTGAGGAGATAGAAACGCTTCCGGATGAT.........GCTCAAATTTACAAGACCGTTGGAACGCTCATAGTCAAGACC...ACAAAGGAGAAGGCCGTCCAGGAGCTTAAGGAAAAGATCGAAACCCTAGAGGTAAGGTTAAATGCCTTGAACAGGCAGGAACAGAAGATAAACGAGAAGGTTAAGGAGCTCACTCAGAAGATTCAAGCC...GCTCTGAGGCCGCCT
TRN  10010101100011010
NAM  PFDB_HALN1/10-115
ASQ  QEKLEQLQDLQEKAQNVATQKQQAEQQLSEAETALDALGDIEES...TTMYREVGELLVET.EYDNAHDDLDEKVSDLEVRVETLQKQEDRVQEQFESLQEELQD.MLGGA
DSQ  CAGGAGAAACTCGAGCAGCTCCAGGATCTGCAGGAGAAAGCGCAGAACGTCGCCACGCAGAAACAGCAGGCCGAACAGCAGCTGTCCGAGGCCGAAACGGCCCTGGACGCGCTCGGCGACATCGAGGAGTCG.........ACCACGATGTACCGTGAGGTCGGCGAGTTGCTCGTGGAAACG...GAGTACGACAACGCCCACGACGACCTCGACGAGAAGGTCAGCGACCTGGAAGTGCGCGTCGAAACCCTCCAGAAGCAGGAGGACCGCGTGCAGGAGCAGTTCGAGAGCCTCCAGGAGGAGCTGCAGGAC...ATGCTCGGCGGTGCG
TRN  11011101101011011
NAM  Q6L0A9_PICTO/11-117
ASQ  QNQIKQAQDIEAQIESIASQRYQLDVLIRELDKTIKELKSISEG...TPVYKSVGPVMYLVeDKNKLINDLEEQKELSQMRSKTLENQQKSLEQKYREVQESLQK.KYQEA
DSQ  CAGAACCAGATAAAGCAGGCACAGGACATAGAGGCACAGATAGAGAGCATAGCCTCTCAGAGGTACCAGCTCGATGTCCTTATAAGGGAGCTTGACAAGACCATAAAGGAATTAAAGTCAATTTCTGAAGGA.........ACACCTGTTTATAAAAGTGTTGGACCCGTTATGTACCTTGTTgagGATAAAAATAAACTTATAAATGATCTTGAGGAACAGAAGGAACTTAGCCAGATGAGGAGCAAGACCCTAGAAAACCAGCAAAAATCACTTGAACAAAAGTACCGCGAGGTGCAGGAATCATTACAAAAA...AAGTATCAGGAAGCC
TRN  10010101110011000
NAM  PFDB_THEVO/11-117
ASQ  QNQLKQAQELEENIEKIATQRYQLDLSLKEIEKTLQELNKIDDK...TPVYRSIGSILYKVdDKKKLIDELEEQLELTKIRINTLDKQQKSLEEKYKELQAAIRE.RYNQD
DSQ  CAAAATCAATTGAAGCAAGCTCAAGAATTAGAGGAAAATATAGAAAAAATAGCAACCCAGAGATACCAGCTGGATCTTAGTTTAAAGGAAATAGAGAAAACCCTTCAAGAACTTAATAAAATAGATGATAAA.........ACTCCGGTTTACAGGAGCATTGGTTCAATACTTTATAAAGTTgatGACAAAAAGAAGCTCATAGATGAGTTGGAAGAGCAGCTTGAACTGACAAAGATAAGGATTAATACCCTTGACAAGCAGCAGAAATCTCTTGAGGAAAAATATAAGGAATTACAGGCCGCAATAAGAGAA...CGTTATAATCAGGAC
TRN  10010101100011000
NAM  Q7SX94_BRARE/10-115
ASQ  QAELEKYQQLQKDVSKSMSARQKLEAQLTENNIVKEELALLDSQ...NTVYKLIGPVLVKQ.DLDEAKATVGKRLEYINGEIQRYETLLKEMERKSEQHREVLSS.LQQEY
DSQ  CAAGCTGAGTTGGAGAAATATCAACAACTCCAGAAAGATGTCAGTAAAAGTATGTCAGCAAGACAGAAACTGGAGGCACAGTTGACTGAAAATAACATTGTAAAGGAGGAGCTTGCCTTACTGGATAGCCAA.........AACACAGTTTACAAACTAATTGGACCAGTTCTGGTCAAGCAA...GATCTAGATGAAGCCAAGGCCACAGTGGGAAAGAGATTGGAATACATCAATGGTGAAATTCAGCGCTATGAGACTTTATTGAAGGAGATGGAGAGGAAGTCTGAGCAGCATCGGGAGGTTTTGTCCAGT...CTCCAGCAGGAGTAC
TRN  10010101100011000
NAM  PFD6_HUMAN/10-115
ASQ  QGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGS...NVVFKLLGPVLVKQ.ELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQ.LQQEF
DSQ  CAGGGAGAAGTGGAGAAATATCAACAGCTACAGAAGGACTTAAGTAAATCCATGTCGGGGAGGCAGAAACTTGAAGCACAACTAACAGAAAATAATATCGTGAAAGAGGAACTGGCCCTGCTGGATGGGTCC.........AACGTGGTCTTTAAACTTCTGGGTCCGGTGCTAGTCAAACAG...GAGCTGGGGGAGGCTCGGGCCACAGTAGGGAAGAGGCTGGACTATATCACAGCTGAAATTAAGCGATACGAATCCCAGCTTCGGGATCTTGAGCGGCAGTCAGAGCAACAGAGGGAGACCCTTGCTCAG...CTGCAGCAGGAGTTC
TRN  10010101100011000
NAM  Q6XHQ2_DROYA/13-118
ASQ  QTEVESYQNLQKSCVKMVKQRALLESQLNENKCVLDELNLLGPD...NKVYKLFGPVLVKQ.ELEESRQNVGKRIEYISKELKSSTDTLESMEKDMQKHQETMAK.YQQQW
DSQ  CAGACCGAGGTTGAGTCATACCAGAACCTGCAAAAATCCTGCGTCAAGATGGTGAAGCAGCGGGCACTGCTAGAAAGCCAACTGAACGAGAACAAGTGCGTCCTGGACGAGCTGAATCTTTTGGGCCCCGAC.........AACAAGGTCTACAAGCTTTTCGGACCCGTTTTGGTCAAGCAG...GAGCTGGAGGAGTCGCGCCAGAATGTCGGAAAGCGCATTGAGTACATCTCCAAGGAGCTGAAGAGCTCCACCGACACTCTGGAGAGCATGGAGAAGGACATGCAGAAGCATCAGGAAACCATGGCCAAG...TACCAACAGCAATGG
TRN  11011101101011001
NAM  Q7Q034_ANOGA/13-118
ASQ  EAELKNFKDTQREFSKLVQTQQQLDGQYFENKSILEELQMLKPT...NTVYKLYGPVLVKQ.DLEESKQNVGKRIEYITKELKRCGENITQLEAKQDKYRANLQK.LQMQY
DSQ  GAAGCGGAGCTGAAAAACTTCAAGGACACGCAGCGAGAGTTCTCGAAGCTCGTGCAAACGCAGCAGCAGCTCGATGGGCAGTACTTCGAAAACAAGAGCATTCTGGAGGAGCTGCAAATGCTGAAGCCAACC.........AACACGGTGTACAAACTGTACGGCCCGGTGCTGGTGAAGCAG...GATCTCGAGGAGAGCAAGCAAAACGTCGGCAAGCGCATCGAGTACATCACGAAGGAGCTGAAGCGGTGCGGGGAGAACATTACGCAGCTGGAAGCGAAGCAGGACAAGTACCGTGCGAACCTGCAGAAG...CTGCAGATGCAGTAC
TRN  11011101101011011
NAM  Q6K3S8_ORYSA/22-128
ASQ  ESQANALSKIQKDISKNHQVRKQYTIQVGENELVLKELELVNDE...ANVYKLIGPVLVKQ.DLAEAKANVKKRIEYISAELKRMDRALKDLEEKQNSKKESISHdRLMSV
DSQ  GAGTCCCAGGCCAACGCCCTCAGCAAGATCCAGAAAGACATCTCCAAGAACCACCAGGTCCGCAAGCAGTACACCATCCAGGTCGGCGAGAACGAGCTCGTCCTCAAGGAGCTGGAGCTGGTGAATGACGAG.........GCGAACGTGTACAAGCTGATCGGGCCGGTGCTGGTCAAGCAG...GATCTCGCGGAGGCGAAGGCCAACGTCAAGAAGCGCATCGAGTACATCTCCGCTGAGCTGAAGCGGATGGATCGAGCGCTCAAGGACTTGGAGGAAAAGCAGAACAGCAAGAAGGAATCGATTTCGCACgatCGTTTAATGTCTGTG
TRN  11011101101011010
NAM  Q8GYJ1_ARATH/14-119
ASQ  ENKANDLGKIQKDIGKNHQLRKKYTIQLGENELVLKELDLLEED...ANVYKLIGPVLVKQ.DLAEANANVRKRIEYISAELKRLDVILQDMEEKQNNKRETIMK.LQQRL
DSQ  GAAAACAAGGCTAATGATCTCGGCAAAATCCAGAAAGATATCGGGAAGAATCATCAGCTGAGAAAGAAGTATACGATCCAACTCGGTGAGAATGAGCTCGTGCTTAAGGAGTTAGATTTGCTGGAAGAAGAT.........GCTAACGTCTACAAATTGATTGGTCCGGTGTTAGTGAAGCAG...GATTTGGCTGAAGCTAATGCAAATGTTCGTAAACGAATTGAGTACATCTCTGCTGAATTGAAACGGCTTGATGTAATTCTTCAAGATATGGAAGAAAAACAAAACAACAAGAGAGAAACGATAATGAAG...TTACAACAAAGGCTA
TRN  10010101100011010
NAM  PFD6_CAEEL/8-113
ASQ  EEEVNKLRTLEKDREKYFTSRQEMEMRLTESKNVKAELDLMESD...SKVYKLIGAVLVRQ.DLEEARSTVEKRLEFIDSETKRVEASISDISKKCTEQRDKVMN.MQKSF
DSQ  GAAGAAGAAGTTAACAAGCTCAGAACTCTTGAAAAAGACCGCGAAAAGTACTTCACGAGTCGCCAAGAGATGGAAATGAGATTAACTGAGAGTAAAAATGTGAAAGCGGAGCTTGATCTGATGGAATCCGAC.........TCGAAAGTCTACAAACTCATCGGAGCGGTTCTTGTTCGTCAA...GATTTGGAGGAGGCTCGATCGACTGTGGAGAAACGGCTTGAGTTTATCGACTCTGAGACCAAACGAGTGGAAGCCAGCATCTCAGACATTTCGAAGAAGTGTACGGAACAGCGAGACAAGGTGATGAAT...ATGCAAAAAAGCTTC
TRN  10010101100011000
NAM  Q7S0H5_NEUCR/10-115
ASQ  QALSDEYQNLNKELQETVLARQKLEAQKQENVSVQNEFEKLKDD...EQIFKLVGPVLLKQ.DKMDAENTVKGRLEFISKEITRLEGVIKETQGKIEKKRTEIIQ.VQTSA
DSQ  CAAGCTCTCTCTGATGAGTATCAAAACCTGAACAAAGAACTCCAAGAGACTGTTCTCGCCAGACAGAAGCTCGAGGCTCAGAAGCAGGAAAACGTCAGCGTGCAAAATGAGTTCGAGAAGCTCAAGGATGAC.........GAGCAGATCTTCAAGCTAGTGGGCCCGGTGCTGCTCAAGCAG...GACAAGATGGATGCAGAGAACACAGTCAAGGGTAGACTGGAGTTCATCAGCAAGGAGATCACTCGCTTGGAGGGAGTCATCAAGGAGACACAGGGCAAGATTGAGAAGAAGAGGACAGAGATCATTCAG...GTCCAGACGAGCGCC
TRN  10010101100011011
NAM  PFD6_SCHPO/2-107
ASQ  EELAKKYQNLQTELSTYVESLKKLETQLQENTTVLNELEKVAPD...SNIYKQIGPTLVKQ.SHEEAKTNVKTRLDFINKEIARLENQTKISQEEFSKVKGAIIQ.AQAAA
DSQ  GAGGAATTAGCTAAAAAATATCAGAACCTACAAACAGAACTAAGCACTTATGTCGAAAGTTTAAAAAAGTTGGAAACCCAATTACAAGAAAACACTACTGTCCTCAATGAATTGGAAAAAGTGGCTCCTGAC.........TCAAATATATATAAGCAAATCGGTCCTACCCTTGTAAAGCAA...AGTCATGAGGAAGCAAAGACCAACGTTAAAACAAGATTGGATTTCATTAATAAAGAAATTGCACGCCTCGAAAATCAAACAAAAATCTCACAAGAAGAATTCAGCAAAGTTAAAGGTGCCATCATTCAA...GCACAAGCAGCAGCT
TRN  10010101110011000
NAM  PFD6_YEAST/2-107
ASQ  SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEED...TPVYKLTGNVLLPV.EQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIK.LNNTA
DSQ  TCTGAATTAGGTGCCAAATATCAACAGTTGCAAAATGAGTTAGAAGAGTTTATTGTGGCCAGACAAAAATTAGAGACACAATTACAAGAAAACAAGATTGTAAATGAAGAGTTTGACCAATTAGAAGAAGAT.........ACACCTGTGTACAAATTGACAGGCAATGTCCTTTTACCAGTT...GAACAAAGTGAGGCACGTACCAACGTGGACAAAAGATTAGAGTTCATCGAAACAGAAATTACAAGATGCGAAAAGAACATAAGGGACAAGCAGGAAGAACTAGAAAAGATGAGAAGCGAGCTAATTAAA...CTGAACAATACAGCA
TRN  10010101100011010
NAM  Q9N6L6_LEIMA/16-121
ASQ  RPILKELQEMGDKKGKLIEARRQLGGQKNENELVRDELNRLEPD...ATVYKLIGPALVPQ.DQSDAKTIIGNRLDYINGEIKRSDTSIAELDRKEAELQKKAQE.LYRKM
DSQ  AGGCCAATTCTGAAAGAGCTTCAGGAGATGGGCGACAAGAAGGGCAAGCTCATTGAAGCCCGCCGTCAGCTTGGTGGGCAAAAGAACGAGAATGAACTAGTGCGTGATGAGCTGAACAGGCTGGAACCCGAT.........GCCACAGTTTACAAGCTTATCGGCCCTGCCCTGGTTCCTCAG...GACCAGAGCGATGCTAAGACAATAATCGGCAACCGCCTGGACTACATCAACGGCGAAATCAAGCGCAGTGACACCAGCATCGCTGAGCTAGATCGAAAGGAGGCGGAGCTGCAGAAGAAGGCCCAAGAG...CTGTACCGTAAGATG
TRN  10010101100011011
NAM  Q8I3Y6_PLAF7/7-105
ASQ  SEIIKDISALKTSCEKLNSQLDELITQKVENEMLLEEVKVLEDD...SVLHKLVGLVLVKE.EKSKCYDTISRRLQYITGEIENRKKVITNSEEKLRK-------.LFSDK
DSQ  AGTGAAATAATAAAAGATATTAGTGCTCTCAAAACAAGTTGTGAAAAACTTAATTCTCAACTAGATGAACTAATTACTCAAAAAGTGGAAAATGAAATGCTACTAGAAGAAGTTAAGGTTTTAGAAGATGAC.........TCGGTTTTACATAAACTTGTTGGCTTAGTTTTAGTAAAAGAA...GAAAAAAGTAAATGTTATGATACAATATCAAGAAGGTTACAATATATCACTGGAGAAATTGAAAATAGAAAGAAGGTTATTACTAATTCGGAGGAAAAACTGAGAAAG---------------------...CTATTTAGCGATAAG
TRN  10010101100011000
NAM  PFD2_DROME/13-118
ASQ  EAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPE...RKCFRQIGGVLCER.TVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNI.KIRGE
DSQ  GAGGCCATTGTGGCCCAGTTCCAACAGCTGCGCAATGAGCAGCGCAATTTGGTCAACAGTTTAAATACGCTCGAAATGGATTTGAGGGAACACAAAACTGTGATAGAAACTCTGGAGGCGGCGGATCCCGAA.........CGGAAATGCTTTCGTCAAATTGGTGGTGTGCTGTGCGAAAGG...ACCGTGAAGGAGGTGCTGCCACAGCTGGTGGAGAACAAGGATTTCATCGCCAAGACCATCCAAATGGTCACCAATGACCTGAGCAAAAAGGGCAGTGAGCTGAACAAGTTCAAGGAGGAGCACAATATC...AAGATTCGCGGCGAA
TRN  10010101100011010
NAM  Q7Q629_ANOGA/13-118
ASQ  EEIAAEFQQLRNQQRNLVNNLNTIEMDLKEHKTVIDTLKTVESS...RKCFRLIGGVLVEQ.TVEVVLPQLELNKAQLEKLIEEGKEQITKKGLEINQFKDEHNI.KVRGQ
DSQ  GAAGAGATCGCGGCCGAATTTCAGCAGCTGCGAAATCAGCAGCGAAATTTGGTCAACAACCTCAACACGATCGAGATGGATCTGAAGGAGCACAAAACCGTCATCGACACACTGAAAACGGTGGAATCGAGT.........AGGAAGTGCTTCCGGCTGATCGGTGGCGTGCTGGTGGAACAG...ACGGTCGAGGTGGTGCTGCCCCAGCTCGAGCTCAACAAAGCGCAGCTGGAGAAGCTGATCGAGGAGGGAAAGGAGCAGATCACGAAAAAGGGGCTCGAGATTAACCAGTTTAAGGACGAGCACAACATT...AAGGTGCGGGGCCAG
TRN  10010101100011011
NAM  PFD2_MOUSE/24-129
ASQ  EQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDET...RKCYRMVGGVLVER.TVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNI.RLMGE
DSQ  GAACAGGTAATTGCTGGCTTTAATCGCCTTCGGCAGGAACAGAGGGGCTTGGCTTCCAAAGCAGCTGAGCTGGAGATGGAATTGAATGAGCACAGCCTGGTGATCGATACACTGAAGGAAGTGGATGAGACC.........CGCAAGTGCTACCGCATGGTTGGAGGTGTGCTGGTGGAGCGG...ACTGTCAAAGAAGTGCTGCCTGCCTTGGAGGGCAACAAGGAGCAGATACAGAAGATCATTGAGACACTGTCACAGCAGCTTCAGGCAAAGGGCAAAGAACTGAACGAATTCCGGGAAAAGCACAACATT...CGTCTCATGGGGGAA
TRN  10010101100011001
NAM  PFD2_ARATH/17-122
ASQ  QAVLNMYEGKRSELSQIYSNITDLEMQVSEHSLVINAIQPLDQS...RKCFRMIGGVLVER.TIKEVLPAVQRNKDGLEEVVRKLYETLEKKKKDLTEFEAKYKI.RITKQ
DSQ  CAAGCTGTTTTGAACATGTATGAAGGCAAGAGATCAGAGCTAAGCCAAATCTACTCCAACATAACCGACCTCGAGATGCAAGTGAGCGAACATTCTCTGGTCATTAACGCCATTCAGCCTCTCGACCAATCG.........AGGAAATGCTTCCGCATGATAGGAGGCGTTCTTGTCGAAAGA...ACCATCAAAGAGGTACTACCAGCTGTCCAACGTAACAAGGACGGACTTGAAGAGGTTGTGAGGAAGCTATACGAGACATTGGAGAAAAAGAAGAAAGATCTTACAGAGTTTGAAGCTAAGTATAAGATC...AGGATAACGAAACAA
TRN  10010101100011001
NAM  PFD2_CAEEL/18-123
ASQ  RKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEPD...QKCFRLISDTLVEY.TVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNI.RLLTE
DSQ  CGAAAAGTCGTCGAAAAGTTCAAGGCTCTACGTGATCAACAACAGGATATCGCCGCCGAAGTGACTCGAATCGAAGAGGAACGACGTGAATTTGGACGTGTTCTCGAAGTGATCAAGGATCTTGAACCGGAT.........CAGAAATGCTTCCGTTTGATTAGTGATACACTTGTCGAGTAT...ACTGTCAAGGATGTTATTCCGGATTTGCAGAATAATATCGCTAATTTGACAATCGTCTCGAAGCAGCTCAACGATCAGCTCGTCGAAAAGGGAAAAGAGCTGAACACTCACAAAACTACACACAACATT...CGTCTGCTCACTGAG
TRN  11011101101011011
NAM  Q9NEG6_LEIMA/15-120
ASQ  EQIVQQYNRMRQEQSAIMSRIAELENESHEHDLVATELRPLNKD...RCCHRLVGGALVEL.TVGEVLPDIEENLAAIREALVQLNKGLMEKEKQMDEFMTKHKL.NRPGA
DSQ  GAGCAGATTGTGCAGCAGTACAATCGCATGCGTCAGGAGCAGAGCGCCATCATGTCCCGCATCGCCGAGCTGGAGAATGAGTCCCACGAGCACGACCTCGTCGCGACCGAACTGCGCCCGCTCAACAAGGAC.........CGCTGCTGTCATCGCCTTGTCGGTGGCGCGCTAGTGGAGCTC...ACGGTGGGCGAGGTGCTGCCGGACATTGAGGAGAACTTAGCCGCCATCCGCGAAGCGCTCGTGCAGCTAAACAAGGGCCTCATGGAGAAGGAGAAACAGATGGACGAGTTCATGACCAAGCACAAGCTG...AACCGCCCCGGCGCG
TRN  11011101101011010
NAM  Q7SF61_NEUCR/12-117
ASQ  QDLQLQYTTYKNTLQQIAQKIGDVEQEAEEHKLVLETLDPLPAD...RKCFRMINGVLVER.TVEDVIPALKTNAEGLKKVLNDLVKQYQNKQEELDKWKKKNNV.QVVQS
DSQ  CAAGACCTTCAGCTTCAGTACACCACTTACAAGAACACTCTGCAACAAATTGCCCAGAAGATTGGCGATGTTGAGCAGGAGGCCGAAGAGCATAAACTCGTCCTCGAAACCTTGGACCCTCTCCCGGCAGAC.........CGCAAGTGCTTCCGCATGATCAATGGCGTCCTGGTCGAGAGG...ACGGTGGAGGACGTGATCCCCGCTTTGAAGACCAACGCCGAGGGTTTGAAGAAGGTTCTGAACGACTTGGTCAAGCAGTACCAGAACAAGCAGGAGGAGCTGGATAAGTGGAAGAAGAAGAACAATGTC...CAGGTTGTTCAGTCA
TRN  10010101100011001
NAM  PFD2_SCHPO/9-114
ASQ  QILQTQYNSYKSRLQQIAQKIVDLETDADEHKLVMDTLNSMDNN...RRCFRMIHGVLVER.TVGTVVPILKTTQEGIQTAMNGLLDQYKQLEAEFQKFQKDNKI.QVVRQ
DSQ  CAGATTCTACAGACGCAGTACAATTCATATAAGTCTCGGTTACAACAAATTGCGCAGAAGATTGTCGATTTGGAAACCGATGCTGACGAACATAAACTTGTTATGGACACATTAAACTCCATGGATAATAAT.........CGACGTTGTTTTCGAATGATCCATGGAGTGCTAGTGGAGAGA...ACGGTGGGAACTGTTGTGCCTATCCTTAAAACTACTCAAGAAGGGATTCAAACAGCCATGAATGGTTTGCTCGACCAGTATAAGCAGCTCGAAGCAGAATTCCAAAAGTTTCAAAAAGACAATAAAATT...CAAGTCGTTAGACAA
TRN  10010101110011000
NAM  Q75AC1_ASHGO/19-124
ASQ  SVLQLKYNEYKQTLEELQTKIIELGNDKEEHEVVLTTLNGVDKA...RKCYRMVGGALVET.DVQTTIPILQTKKENLSSTISALKGELVKVAEEFEKWKKDNKI.QVLKQ
DSQ  TCAGTCCTTCAGTTGAAATATAACGAGTACAAGCAGACACTAGAAGAGCTACAGACAAAGATAATAGAGCTTGGAAATGATAAAGAAGAACATGAAGTGGTGCTAACTACACTCAACGGAGTCGATAAAGCC.........AGAAAGTGCTACCGCATGGTCGGAGGAGCGCTTGTTGAGACA...GATGTCCAAACCACTATTCCAATCTTGCAGACCAAGAAGGAGAACTTATCCTCCACTATTAGTGCTCTGAAAGGCGAGCTCGTGAAAGTCGCGGAGGAATTCGAGAAATGGAAGAAGGATAATAAGATT...CAAGTCCTTAAACAG
TRN  10010101100011000
NAM  PFD2_YEAST/18-123
ASQ  IVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPT...RKCYRMIGGALVES.DVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKI.QVVKN
DSQ  ATAGTCTTTCAAGCAAAATATAATGAATACAAACAAATTTTGGAAGAATTGCAAACAAAAATCATAGAATTAGGTCATGACAAAGATGAACACACTATAGTCATAAAAACACTGAAAGACGCTGAGCCGACG.........AGAAAATGTTACAGGATGATAGGTGGCGCACTTGTTGAAAGT...GATGTTCAAACGAGTTTGCCTATTCTTGAAACTAAGAAGGAAAACATAGAAGGTACAATAAGTAAAATGAAAGAAACCTTAATACAAACTGCAAAAGAGTTTGAAAAATGGAAAAAAGACAATAAGATT...CAAGTCGTTAAAAAC
TRN  10010101100011010
NAM  Q8ILS7_PLAF7/18-118
ASQ  SKLT--YEQIEKDRVQLVSKIEELYQDVVEHKLVLEALENVPSD...RRCYRMVGEVLVER.TVGEIKPALMDHKNKVEQVIAECQKQLDQKNNEISNFIKSAK-.--AGN
DSQ  TCTAAATTAACA------TATGAACAAATTGAAAAAGATAGAGTTCAGTTAGTTTCAAAAATAGAAGAATTATATCAAGATGTAGTTGAACACAAATTAGTGCTTGAAGCGTTGGAAAATGTACCATCAGAT.........AGAAGGTGCTACAGAATGGTTGGAGAAGTTTTAGTTGAAAGA...ACAGTCGGGGAAATTAAGCCAGCTTTGATGGACCATAAAAATAAGGTTGAACAGGTTATAGCTGAATGTCAAAAACAATTAGACCAAAAGAATAATGAAATATCAAATTTTATAAAAAGTGCTAAG---...------GCGGGAAAT
TRN  10010101110011000
NAM  Q90634_CHICK/80-171
ASQ  NVLQAQLQRLQEDIENLREEKES------EISSTRNELVSAQNE...---------ILSLQqVAEKAASERDTDISALQEELQTVRAELERWRKDASDYEKEIVS.LQASF
DSQ  AATGTTCTGCAAGCTCAGTTGCAGAGGTTACAGGAAGATATTGAGAATCTTCGTGAGGAGAAGGAGAGT------------------GAAATTTCTAGCACTCGAAACGAACTAGTCAGTGCTCAGAATGAG.........---------------------------ATTCTGTCACTTCAAcaaGTAGCAGAAAAGGCAGCATCAGAACGAGATACAGATATTTCTGCTTTGCAAGAAGAACTACAGACTGTGCGAGCGGAACTGGAACGGTGGCGGAAAGATGCCTCAGATTATGAAAAAGAAATTGTCAGT...CTACAAGCCAGTTTT
TRN  10010101100011000
NAM  Q8VC86_MOUSE/177-268
ASQ  QVLQVQLQKLHMDMENLQEEKDT------EISSTRDKLLSAQDE...---------ILLLRqAAAEAVSERDTDFVSLQEELKKVRAELEGWRKAASEYENEIRS.LQSSF
DSQ  CAGGTTCTTCAAGTCCAGCTGCAGAAGTTACACATGGACATGGAGAATCTCCAGGAGGAAAAGGACACG------------------GAAATCTCCAGCACAAGAGATAAATTGCTTAGTGCCCAAGATGAG.........---------------------------ATTTTGCTCCTTCGTcaaGCAGCAGCAGAGGCTGTGTCTGAGCGGGACACTGACTTTGTTTCTTTGCAAGAAGAGCTTAAGAAGGTCAGAGCGGAGCTTGAGGGCTGGAGGAAAGCAGCGTCTGAATACGAGAATGAAATCAGAAGT...CTGCAGAGCAGCTTC
TRN  10010101100011010
NAM  Q8NCW9_HUMAN/19-110
ASQ  QVLQAQLQRLHIDTENLREEKDS------EITSTRDELLSARDE...---------ILLLHqAAAKVASERDTDIASLQEELKKVRAELERWRKAASEYEKEITS.LQNSF
DSQ  CAGGTTCTTCAAGCCCAATTGCAGAGGTTACACATCGATACTGAGAATCTCCGGGAGGAGAAGGACAGT------------------GAAATCACAAGTACTAGAGATGAATTGCTTAGTGCCCGAGATGAA.........---------------------------ATTTTGCTCCTTCATcaaGCAGCAGCAAAGGTTGCCTCTGAGCGGGACACTGACATTGCTTCTTTACAAGAAGAGCTTAAGAAGGTGAGAGCTGAGCTTGAGCGGTGGCGGAAAGCAGCGTCTGAATATGAGAAAGAAATCACAAGT...CTGCAAAACAGTTTT
TRN  10010101100011010
NAM  Q9VMH8_DROME/13-118
ASQ  TEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLADD...TRVYQSVGRMFLLT.DVQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRE.LVQQR
DSQ  ACCGAGATGCAGATCAATAAGCTGGAGACGACCAAGAAGATCCACATGATCGACATGAAGTGCGACATGGTCAAGACAGGCAAACAAAAGTACCAGCTGACAGAAAAGGGCACCAGCAGCTTGGCCGACGAC.........ACAAGAGTTTACCAGTCCGTGGGTCGCATGTTCCTGCTTACC...GATGTACAGAATATGCGCGAGGACCTGAAGGCTAGGCAGGAGAAATGCGACAAAGCGATAGAACTGCTGGAGAAGAAGAAGGAGTTCTTGCAGAAGTCCCTTAAGAGCCAGGAAGACGGTCTGCGCGAG...TTGGTGCAGCAGCGC
TRN  10010101100011011
NAM  Q7Q0Q5_ANOGA/3-108
ASQ  TEMQVNKIESTKKIRLLDMKMDSLKLSKQRIEVTNRHISNLAPE...TRVYASVGRMYVLN.DVPTLTEQLKTTHASYEEIITQCEKNKDFLIKNLKEQEESLRE.LVQQK
DSQ  ACTGAAATGCAGGTGAACAAGATCGAGTCAACAAAGAAGATCCGGCTACTTGATATGAAAATGGACAGTCTGAAGCTTTCGAAGCAACGCATTGAAGTAACGAATCGACACATCTCCAACCTTGCTCCAGAA.........ACTAGAGTGTACGCGTCGGTGGGGCGTATGTACGTGCTGAAC...GATGTTCCGACACTAACCGAACAGCTGAAAACGACCCATGCTTCCTACGAAGAAATAATTACTCAGTGTGAAAAGAACAAAGACTTCTTGATCAAAAATCTCAAGGAGCAGGAAGAGAGCCTTCGTGAG...CTGGTGCAGCAGAAA
TRN  10010101100011001
NAM  PFD1_CAEEL/11-116
ASQ  RDLQFKTNETRMRIVQGEQNKKVNYQKMRISESTKKNLVDLDEN...LKYYRSVGRMFLLT.DKPAEISRHEAEAKQSKEKIEAIEKQKDYLEKGLVEAETNLRE.LIQSR
DSQ  CGCGACTTGCAATTCAAAACCAATGAAACACGAATGCGGATAGTTCAAGGAGAACAAAATAAGAAAGTTAACTATCAGAAAATGAGGATCTCAGAGAGCACAAAAAAGAACTTGGTGGATTTGGATGAAAAC.........CTCAAGTACTATCGATCTGTTGGGCGTATGTTCCTGCTGACC...GACAAACCAGCTGAAATTTCCAGACATGAAGCTGAAGCTAAACAGTCAAAAGAGAAAATTGAAGCTATCGAGAAGCAGAAAGACTATTTGGAGAAAGGATTGGTGGAGGCTGAAACGAATCTTCGCGAG...CTGATTCAAAGTAGA
TRN  10010101100011001
NAM  Q94AF7_ARATH/11-116
ASQ  MEIQASMIELTGKLKQVQNQMRNKEGDRKRAFLTLEELRPLPEE...TNTYKSIGRTFVLE.PKTVLEGEQEQKLKDSEAAVASLQTSKEYLEKQVAEVENNLRE.LLQQE
DSQ  ATGGAGATTCAAGCTAGCATGATTGAACTCACTGGGAAGCTCAAACAGGTGCAGAATCAGATGCGCAACAAAGAGGGAGATAGAAAGCGAGCTTTCTTAACCTTGGAGGAGCTGAGGCCATTGCCTGAAGAG.........ACAAACACCTACAAGTCAATAGGAAGAACGTTTGTTCTAGAG...CCCAAGACAGTGCTGGAGGGTGAACAAGAGCAAAAACTCAAGGACAGTGAAGCTGCCGTTGCTTCTCTACAGACATCCAAGGAATACTTGGAGAAGCAGGTAGCAGAGGTTGAGAACAACTTGAGGGAG...CTGTTGCAGCAAGAA
TRN  10010101100011000
NAM  PFD1_HUMAN/14-119
ASQ  TELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDE...TNMYEGVGRMFILQ.SKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIRE.MLMAR
DSQ  ACAGAGCTTCAAGCCAAAGTTATTGACACTCAACAGAAGGTGAAGCTCGCAGACATACAGATTGAACAGCTAAACAGAACGAAAAAGCATGCACATCTTACAGATACAGAGATCATGACTTTGGTAGATGAG.........ACTAACATGTATGAAGGTGTAGGAAGAATGTTTATTCTTCAG...TCCAAGGAAGCAATTCACAGTCAGCTGTTAGAGAAGCAGAAAATAGCAGAAGAAAAAATTAAAGAACTAGAACAGAAAAAGTCCTACCTGGAGCGAAGCGTTAAGGAAGCTGAGGACAACATCCGGGAG...ATGCTGATGGCACGA
TRN  10010101100011010
NAM  Q9P3P3_NEUCR/13-118
ASQ  REIEAQSIAAQQQIGLVRTQQASKQREMRLAQLTRNELATLPET...TAVYEGVGKMFVSV.PVPALKDRLSTEMKEMETEVENLGKRLHYLETTAKNSQEHIEK.MLKGG
DSQ  CGTGAGATCGAAGCGCAGTCGATCGCGGCTCAGCAACAAATTGGTCTCGTCCGCACCCAACAAGCATCCAAGCAGCGTGAGATGCGTCTGGCCCAGCTCACACGGAATGAGCTCGCCACGTTGCCCGAGACC.........ACTGCCGTGTATGAGGGCGTTGGGAAGATGTTCGTCTCCGTC...CCTGTCCCGGCATTGAAGGATAGGTTGAGCACCGAGATGAAGGAGATGGAGACCGAGGTGGAGAACCTGGGCAAGAGGTTGCACTACCTCGAGACGACAGCGAAGAACAGCCAGGAGCATATCGAGAAG...ATGCTCAAGGGTGGT
TRN  10010101100011011
NAM  Q757Z9_ASHGO/9-112
ASQ  QEIAAGLRNSKGQLELVTAQLAQLQRQKKLAHVTAKELGSYPVD...-QVWRSCGKMFLLD.SKTDYTQQLDADAKTIEEQIKALEVKRHYLETTVENSIEALKK.-AVQR
DSQ  CAGGAAATCGCCGCTGGTCTGCGCAACAGCAAGGGCCAGCTCGAGTTGGTGACGGCACAATTGGCACAGCTGCAGCGGCAGAAGAAGCTGGCGCATGTCACGGCCAAGGAACTGGGGTCGTATCCGGTGGAT.........---CAGGTGTGGCGGTCGTGCGGCAAGATGTTCCTGCTGGAC...AGCAAGACTGATTACACGCAGCAGCTGGATGCAGACGCAAAGACCATTGAGGAGCAGATCAAGGCGCTCGAGGTGAAGCGGCACTACCTCGAGACCACGGTGGAGAACTCCATCGAGGCACTGAAGAAG...---GCGGTCCAGAGG
TRN  10010101100011011
NAM  PFD1_SCHPO/6-111
ASQ  SQIQEKAVDSQQQLRTIMVQIAAKERALKISELAKKELEDVGED...KAVYTSLGKMFMKS.DLASVRTHLDAEMASLREDIEALQKKQTYHETTASNAEQHLQK.IKESI
DSQ  AGTCAAATACAAGAGAAAGCGGTTGATTCACAGCAACAACTGAGGACCATAATGGTACAGATTGCTGCCAAGGAACGGGCACTAAAAATAAGTGAATTAGCCAAAAAAGAGTTAGAGGATGTTGGAGAAGAT.........AAGGCCGTATATACTTCTCTTGGAAAGATGTTTATGAAATCC...GATTTGGCTTCCGTACGTACACATTTGGACGCAGAAATGGCAAGTTTAAGAGAAGATATTGAAGCACTACAAAAGAAACAAACATATCACGAAACAACGGCCTCAAATGCTGAGCAGCATTTACAAAAG...ATAAAAGAGTCGATT
TRN  10010101100011000
NAM  PFD4_SCHPO/11-119
ASQ  QRNLNEFSVLHSRKAIQELDIKNLKTQIEDIVDAKNECELLDEDdgdDIPALKVGDAFFQV.SLPVLLDQLEQSEESLEKQVDVLRSSMEKDETRIQELKSMLYS.KFHDQ
DSQ  CAAAGGAATTTAAATGAATTTTCAGTGTTGCATTCTCGAAAGGCCATTCAAGAACTTGATATTAAGAATTTAAAAACGCAAATAGAGGATATTGTTGACGCTAAAAATGAATGTGAATTACTAGACGAGGATgatggagacGATATTCCAGCTTTAAAGGTTGGCGATGCCTTTTTCCAAGTT...TCCCTTCCTGTACTCCTTGACCAGCTTGAGCAGTCAGAAGAAAGTTTGGAAAAGCAAGTCGACGTATTAAGATCTTCCATGGAAAAAGACGAAACCCGCATTCAAGAGTTGAAATCAATGCTGTACTCT...AAATTTCACGATCAA
TRN  10010101100011000
NAM  PFD4_HUMAN/20-126
ASQ  QQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDD..cLMIPYQIGDVFISH.SQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYA.KFGSN
DSQ  CAACAAAAGATAAACAAATTTGCACGGAATACAAGTAGAATCACAGAGCTGAAGGAAGAAATAGAAGTAAAAAAGAAACAACTCCAAAACCTAGAAGATGCTTGTGATGACATCATGCTTGCAGATGATGAT......tgcTTAATGATACCTTATCAAATTGGTGATGTCTTCATTAGCCAT...TCTCAAGAAGAAACGCAAGAAATGTTAGAAGAAGCAAAGAAAAATTTGCAAGAAGAAATTGACGCCTTAGAATCCAGAGTGGAATCAATTCAGCGAGTGTTAGCAGATTTGAAAGTTCAGTTGTATGCA...AAATTCGGGAGCAAC
TRN  10010101100011000
NAM  Q8MRY9_DROME/26-131
ASQ  QQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDED...EDIPFLVGEVFLSH.KLEKTQDMLKETKEQVLKEIAVVEAKAKVIKAEMDELKAHLYQ.RFGSN
DSQ  CAGCAGCGGATCAACCGCTTTGCGAAGCACAACGCCCGCATGGATGACTTCAAAGCGGAGCTGGAAACGAAGCGCAATGAGCTGAAGAGCTTGGAGGAGGCGCTGGAGGAGATTGAGCTGTTCGACGAGGAC.........GAGGACATACCGTTCCTGGTTGGCGAGGTGTTCCTCTCGCAC...AAGCTGGAGAAAACACAGGACATGCTGAAGGAGACCAAGGAGCAGGTGCTCAAGGAGATCGCCGTCGTGGAAGCCAAGGCGAAGGTTATCAAGGCGGAAATGGACGAGCTGAAGGCTCATCTGTATCAG...CGATTCGGCAGCAAT
TRN  10010101100011011
NAM  Q7QIM0_ANOGA/9-114
ASQ  QMKINKFANYNAKVEDLKEELRIKQNELKNLEEAGDEIELLDDD...VQIPFLMGDVFLSH.DQAKTLELLAEAKERKKKEINGIQQISRDLQQKMSDLKGYLYG.RFGSN
DSQ  CAGATGAAGATAAATAAGTTCGCCAACTACAATGCGAAGGTGGAGGACCTGAAGGAGGAGCTGCGCATCAAACAGAACGAGCTGAAAAATCTCGAAGAAGCGGGCGATGAAATAGAGCTGCTGGACGACGAC.........GTACAGATCCCGTTCCTGATGGGGGACGTGTTTCTCTCGCAC...GATCAGGCCAAAACGCTCGAGCTGCTGGCGGAAGCGAAGGAGCGCAAAAAGAAGGAAATCAACGGCATCCAGCAGATCAGCCGCGATCTGCAGCAGAAGATGAGCGACCTGAAGGGTTACCTGTACGGT...CGGTTCGGCAGCAAT
TRN  10010101100011011
NAM  Q754N3_ASHGO/35-140
ASQ  QQRINEFSKLVMRKDALEAELRSQRQEKEYVDDAALEIELVDED...AALQYKIGDVFVLM.RQEEVAAQLERDQAAADARIRQLEEEEEHVDARMRALKQVLYA.KFGDS
DSQ  CAGCAGCGCATCAACGAGTTCTCGAAGCTCGTGATGCGCAAGGACGCGCTGGAGGCCGAGCTGCGCAGCCAGCGGCAGGAAAAAGAGTACGTGGACGACGCGGCGCTGGAGATCGAGCTCGTGGACGAGGAC.........GCGGCGCTGCAGTACAAGATCGGCGACGTGTTTGTGCTGATG...CGGCAGGAGGAGGTGGCCGCGCAGCTGGAGCGCGACCAGGCCGCGGCGGACGCGCGCATCCGGCAGCTGGAGGAGGAGGAGGAGCACGTGGACGCGCGCATGCGCGCGCTGAAGCAGGTGCTGTACGCA...AAGTTCGGGGACAGT
TRN  11011101101011011
NAM  PFD4_YEAST/19-124
ASQ  QQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELIDED...EPVQYKVGDLFIFM.KQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYA.KFGDN
DSQ  CAGCAAAAGATCAACGAGTTTTCGAAGTTGATTATGCGTAAGGACGCCATTGCGCAGGAATTGAGTTTACAGAGGGAGGAGAAGGAGTACCTCGATGATGTGTCTCTAGAAATTGAATTGATTGACGAAGAT.........GAGCCCGTGCAATACAAGGTGGGCGACCTCTTTATCTTCATG...AAACAGAGCAAAGTTACCGCACAGCTCGAAAAAGACGCAGAACGTCTCGACAACAAAATAGAGACTTTAGAGGACAAGCAAAGAGACATTGATTCCCGTCTTGATGCTCTGAAGGCGATCCTGTATGCT...AAATTTGGTGATAAT
TRN  10010101100011010
NAM  Q6UNN7_9HYPO/29-134
ASQ  QDKINKFSRLHQRELALEEQLKGKSKEKEELDDLSTELELADED...EKIQYKIGDAFFHI.PLEQAQEMLETATTRIEDETSELEEKMSTVREEMQQLKVELYA.RFGRQ
DSQ  CAGGATAAGATCAATAAGTTCAGTCGTCTGCATCAAAGGGAGCTGGCCCTAGAAGAGCAGCTTAAGGGGAAGAGTAAGGAGAAGGAAGAACTGGACGATTTGTCGACCGAATTAGAGCTTGCAGACGAGGAC.........GAGAAAATTCAATACAAAATCGGCGATGCATTCTTTCACATT...CCACTAGAGCAAGCACAAGAGATGCTGGAGACGGCCACGACAAGAATAGAAGACGAGACGAGCGAATTGGAAGAAAAGATGAGCACGGTGCGCGAGGAGATGCAGCAGCTCAAGGTCGAGCTCTACGCA...AGATTCGGAAGGCAA
TRN  10010101100011010
NAM  Q8X061_NEUCR/25-131
ASQ  QDKINRFSRLHQRELALEEELKNKNKEKEELDDLETELELVEDE..dELVQYKIGDSFFHI.PLEQAKEMLGIAAAKLIKEIEALDDKLETIRKEMTGLKVELYA.RFGKT
DSQ  CAGGACAAGATCAACAGGTTCAGCCGATTGCACCAGCGCGAACTCGCCCTCGAAGAGGAGCTCAAGAACAAAAACAAGGAGAAGGAGGAACTCGACGACTTGGAAACCGAACTGGAGCTTGTCGAGGACGAG......gacGAGCTTGTCCAGTACAAGATTGGCGATTCCTTCTTCCACATT...CCCCTCGAACAAGCCAAGGAGATGCTCGGCATCGCGGCTGCAAAACTCATCAAGGAGATCGAAGCCCTCGATGACAAGCTTGAAACCATCCGCAAGGAGATGACGGGGCTCAAGGTGGAATTGTACGCA...AGATTTGGAAAGACA
TRN  10010101100011011
NAM  Q9AR47_MAIZE/16-120
ASQ  QQNINRFGRLNNRLHELQDEIKLAKETNENLDDAGNELILSDED...-VVRFQIGEVFAHM.PRDDVETRLEQMKEDAAKKLERLEEEKESILAQMAELKKILYG.KFKDA
DSQ  CAGCAGAACATCAACCGCTTCGGTCGCCTCAACAACCGCCTCCACGAGCTCCAGGACGAGATCAAGCTCGCGAAGGAGACGAATGAGAACCTTGATGATGCTGGGAATGAACTCATCTTGTCGGATGAAGAC.........---GTTGTACGCTTCCAAATTGGGGAAGTGTTTGCTCACATG...CCAAGGGATGACGTCGAGACTAGGCTGGAGCAGATGAAAGAGGATGCGGCTAAGAAGCTGGAGAGGTTAGAGGAGGAAAAGGAATCCATCCTGGCCCAGATGGCCGAGCTGAAGAAGATACTGTACGGG...AAGTTCAAGGATGCC
TRN  10010101100011010
NAM  Q8LDK1_ARATH/19-123
ASQ  QQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADEE...-MVRFQIGEVFAHV.PRDDVETKIEEMKEATCKSLEKLEQEKESIVTQMAALKKVLYA.KFKDS
DSQ  CAGCAGAACATTAATATCTTCAGCCGTCTCAACAACAGAGTCCATGACCTCGATGACGATATCAAATCCGCCAAGGAAAAGTGTGAAAATCTAGAGGATGCAGGGAACGAGTTGATCCTTGCTGATGAGGAG.........---ATGGTGCGTTTTCAAATAGGAGAAGTGTTTGCTCATGTG...CCGAGGGACGACGTAGAAACAAAGATAGAAGAGATGAAAGAAGCGACCTGCAAAAGCCTTGAGAAACTCGAGCAAGAGAAGGAATCAATTGTAACACAAATGGCAGCGCTGAAGAAGGTATTGTATGCT...AAGTTCAAAGATTCT
TRN  10010101100011001
NAM  Q7RAS5_PLAYO/64-169
ASQ  QKKIGKFTNLHYKQSLYQQKIKLMKEKISNIDSAIDEVSLVFDP...NDVMLGIGDCFFSF.DTEYVEESLEKSKNEEKVNLNKLECEYKNITDEKQKLKTELYA.KFGNR
DSQ  CAAAAGAAAATTGGAAAATTCACAAATTTACACTATAAGCAGTCCCTTTATCAACAAAAAATAAAATTAATGAAAGAAAAAATTTCAAACATTGATTCTGCTATAGACGAAGTTTCGCTTGTATTCGATCCT.........AATGATGTTATGTTAGGCATAGGTGACTGCTTTTTCTCCTTT...GACACAGAATATGTAGAAGAAAGCTTAGAAAAATCCAAAAATGAAGAAAAAGTAAATTTAAATAAATTAGAATGTGAATACAAAAATATAACTGATGAAAAACAAAAATTAAAAACTGAATTATATGCA...AAATTTGGAAATAGA
TRN  10010101110011000
NAM  Q8I3A4_PLAF7/20-125
ASQ  QKKIGKFTNLHYKEPLYEHKIKMMKENIMNIDSSIDEVSLAFDS...NDIMLNIGDCFFKF.DLDYIEEHLEDRKSEELANLNEMELEYKTKLNEKQKLKTELYA.KFGNR
DSQ  CAAAAAAAAATTGGAAAGTTTACAAATCTACATTATAAAGAACCATTATATGAACATAAAATAAAAATGATGAAAGAAAATATTATGAATATTGATTCTTCTATTGATGAAGTTTCATTAGCTTTTGATTCA.........AATGATATTATGTTAAATATAGGTGACTGCTTTTTTAAATTC...GATTTGGATTATATCGAAGAACATTTAGAGGATAGAAAATCTGAAGAGCTCGCAAATTTAAATGAAATGGAATTAGAATATAAAACAAAACTAAATGAAAAGCAAAAATTAAAAACAGAACTGTATGCG...AAGTTTGGAAATAGG
TRN  10010101100011000
NAM  PFD4_CAEEL/12-119
ASQ  QALLNKFARSYQTQTQLKADVKEAKTLIDNINEASDEILLLDDEd.sASIPCRIGSCFVHF.NGDSLNEHLEGKKTTAEKVLSEKTSELDAISADMEQIKKVLYA.KFGDQ
DSQ  CAAGCGCTTCTCAATAAATTCGCTCGGTCATACCAAACACAAACCCAGTTAAAAGCAGACGTTAAAGAAGCTAAAACACTCATTGACAATATCAATGAAGCAAGTGATGAAATTTTGTTGCTCGATGATGAGgat...tcaGCATCAATTCCATGCAGAATTGGAAGCTGCTTCGTTCATTTC...AATGGGGATAGTCTGAATGAGCATTTGGAAGGAAAGAAGACAACAGCAGAGAAGGTTTTGTCTGAGAAAACCTCCGAGTTGGATGCAATCTCAGCGGACATGGAGCAAATCAAGAAGGTTTTGTACGCC...AAATTCGGAGATCAG
TRN  10010101100011000
NAM  Q7QQY6_GIALA/22-128
ASQ  QQMINTFARLHMVYVELAEQRKVLKKRLDDIESASVALLELDDT..eVKPMLAIGAAFFPN.DSMDIDNSLEALKATVSQEYEVVSNRCSKIEAKLNQLRDVLQQ.KFKGS
DSQ  CAGCAGATGATCAACACCTTTGCCCGGTTGCACATGGTTTATGTGGAGTTGGCAGAGCAGCGCAAGGTTCTCAAGAAGCGTCTCGATGACATAGAGAGCGCATCAGTTGCTCTTTTAGAGCTTGATGATACG......gagGTGAAGCCGATGCTCGCTATCGGGGCGGCTTTCTTCCCAAAC...GACTCCATGGACATTGATAACTCGCTGGAGGCTCTAAAGGCAACAGTCTCGCAAGAATACGAAGTCGTCTCTAATCGCTGTAGCAAGATAGAGGCCAAGCTCAATCAACTACGTGATGTGCTCCAACAG...AAATTCAAGGGTTCG
TRN  10010101100011000
//