EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01912 - eIF-6)
FAM  PF01912
PID  eIF-6
DES  eIF-6 family
IPR  IPR002769
ANO  9
ALN  209
AID  0.363289
APH  (((((IF6_METJA/5-207:0.60899,(IF6_PYRHO/4-206:0.41496,IF6_METTH/3-199:0.62576):0.10725):0.12189,(IF6_ARCFU/1-195:0.75705,IF6_SULAC/4-203:0.64911):0.13245):0.77848,IF6_ARATH/3-206:0.30444):0.09435,IF6_YEAST/3-204:0.10924):0.03515,IF6_DROME/3-204:0.11322,IF6_CAEEL/3-204:0.38376);
ATP  (((((IF6_METJA/5-207,(IF6_PYRHO/4-206,IF6_METTH/3-199)),(IF6_ARCFU/1-195,IF6_SULAC/4-203)),IF6_ARATH/3-206),IF6_YEAST/3-204),IF6_DROME/3-204,IF6_CAEEL/3-204);
ATL  5.23609
DNO  8
DLN  627
DID  0.462867
DPH  ((((((IF6_ARATH/3-206:0.31561,IF6_YEAST/3-204:0.22433):0.12427,IF6_DROME/3-204:0.18404):0.04238,IF6_CAEEL/3-204:0.32067):0.46785,IF6_METTH/3-199:0.30367):0.15981,IF6_ARCFU/1-195:0.64253):0.06548,IF6_PYRHO/4-206:0.39448,IF6_METJA/5-207:0.54706);
DTP  ((((((IF6_ARATH/3-206,IF6_YEAST/3-204),IF6_DROME/3-204),IF6_CAEEL/3-204),IF6_METTH/3-199),IF6_ARCFU/1-195),IF6_PYRHO/4-206,IF6_METJA/5-207);
DTL  3.80349
RID  0.382558
RPH  ((((((IF6_CAEEL/3-204:0.38182,IF6_DROME/3-204:0.11235):0.03708,IF6_YEAST/3-204:0.10450):0.08685,IF6_ARATH/3-206:0.31155):0.67320,IF6_ARCFU/1-195:0.84254):0.13379,IF6_METJA/5-207:0.60495):0.12455,IF6_PYRHO/4-206:0.42701,IF6_METTH/3-199:0.59431);
RTP  ((((((IF6_CAEEL/3-204,IF6_DROME/3-204),IF6_YEAST/3-204),IF6_ARATH/3-206),IF6_ARCFU/1-195),IF6_METJA/5-207),IF6_PYRHO/4-206,IF6_METTH/3-199);
RTL  4.43454
LNK  IF6_ARATH/3-206:O22290:AC003000
LNK  IF6_ARCFU/1-195:O28214:AE000961
LNK  IF6_CAEEL/3-204:O62106:Z99709
LNK  IF6_DROME/3-204:P56538:AE003462
LNK  IF6_METJA/5-207:Q60357:U67463
LNK  IF6_METTH/3-199:O27648:AE000920
LNK  IF6_PYRHO/4-206:O58264:AP000002
LNK  IF6_SULAC/4-203:P38619:
LNK  IF6_YEAST/3-204:Q12522:Z71255
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IF6_YEAST/3-204
ASQ  TRTQFENSN-EIGVFSKLTNTYCLVAVG.GSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDS-VKIQRVEER--LSALGNVICCNDYVALVHPDIDRETEELISDVLGVE-VFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLV.AGTVNRGSSVVGAGMVVNDYLA
DSQ  ACCAGGACTCAATTTGAAAACTCCAAT---GAAATCGGTGTATTCTCCAAATTAACGAATACTTACTGTTTGGTTGCTGTTGGT...GGTTCTGAAAACTTTTACTCTGCATTTGAAGCTGAATTAGGAGATGCTATTCCCATCGTTCATACCACTATTGCTGGTACGCGTATCATCGGTAGAATGACCGCGGGTAACCGTAGAGGTCTGCTAGTTCCAACCCAAACTACTGATCAAGAATTACAACATTTAAGAAATAGTTTGCCGGATTCC---GTTAAGATTCAAAGGGTAGAGGAAAGA------CTATCTGCCTTGGGTAACGTCATCTGTTGTAATGATTACGTTGCTTTAGTGCATCCAGATATCGACAGAGAAACTGAAGAATTGATAAGTGATGTACTAGGCGTTGAG---GTCTTCCGTCAAACCATATCAGGTAATATCTTAGTTGGGTCATATTGTTCTTTAAGTAATCAAGGTGGGTTAGTGCATCCACAAACAAGTGTCCAAGATCAAGAAGAATTGTCCTCCTTATTACAAGTTCCTTTGGTG...GCTGGTACCGTTAACCGTGGTAGTTCAGTTGTCGGTGCCGGTATGGTTGTGAACGATTACTTGGCA
TRN  10010101100011000
NAM  IF6_DROME/3-204
ASQ  LRVQFENND-DIGVFTKLTNTYCLVAIG.GSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVGNRNGLLVPNSTTDEELQHLRNSLPDA-VKIYRVEER--LSALGNVIACNDYVALVHPDLDKETEEIIADVLKVE-VFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLV.AGTVNRGSEVLAAGMVVNDWLS
DSQ  CTACGCGTCCAATTCGAGAACAACGAC---GACATCGGCGTCTTCACTAAACTAACCAACACATACTGCCTGGTGGCCATCGGT...GGATCCGAGACCTTCTACAGCGCCTTCGAGGCGGAGCTGGGCGACACCATCCCGGTGGTGCATGCGAATGTGGGCGGCTGCCGGATCATCGGCCGCCTCACCGTGGGCAACCGCAACGGCCTGCTGGTGCCCAACTCCACCACCGACGAGGAGCTGCAACACCTGCGTAACAGCCTGCCAGACGCC---GTGAAGATTTATCGTGTGGAGGAGCGC------CTGTCCGCGCTGGGCAACGTTATCGCCTGCAATGATTATGTGGCCCTGGTGCACCCGGATCTGGACAAGGAGACCGAGGAGATCATCGCGGACGTGCTCAAAGTAGAG---GTCTTCCGCCAGACCATTGCCGACAACTCACTGGTGGGCTCTTACGCCGTGCTGAGCAACCAGGGCGGCATGGTGCATCCCAAGACGAGCATTCAGGACCAGGACGAACTGTCGTCCCTGCTGCAGGTTCCCCTCGTG...GCCGGAACAGTGAACCGGGGCAGCGAAGTACTCGCCGCCGGCATGGTCGTCAACGACTGGCTCTCC
TRN  11011101101011001
NAM  IF6_CAEEL/3-204
ASQ  LRVDYEGSN-DVGVFCTLTNSYCLVGVG.GTQNFYSILEAELSDLIPVVHTSIASTRIVGRLTVGNRHGLLVPNATTDQELQHLRNSLPDE-VAIRRVDER--LSALGNVIACNDHVAIVHAEISAETEQALVEVLKVE-VFRVSLAQNSLVGSYCILSSNGCLVAARTPPETQREIAALLQIPVV.AGTCNRGSELIGAGMVVNDWVA
DSQ  CTCCGCGTCGATTACGAAGGATCGAAC---GATGTCGGTGTGTTCTGCACCCTCACCAACAGCTACTGCCTCGTCGGCGTCGGT...GGCACTCAGAACTTTTACAGTATTTTGGAGGCCGAGCTCAGCGATCTCATCCCAGTCGTGCACACGTCGATCGCCTCGACCAGAATTGTCGGAAGACTTACAGTCGGAAATCGTCACGGACTTCTCGTACCAAACGCCACGACTGATCAGGAGCTTCAACACTTGAGAAACTCGCTTCCAGATGAG---GTCGCAATTCGCAGAGTTGACGAGCGT------CTTTCCGCTTTGGGAAATGTTATCGCTTGTAACGACCACGTCGCTATTGTTCACGCAGAAATTAGCGCAGAAACTGAGCAGGCGCTCGTCGAAGTGCTCAAAGTGGAA---GTATTCCGTGTCAGTCTCGCCCAAAACTCGCTCGTCGGCAGCTACTGCATTCTCAGCTCTAACGGTTGCCTCGTGGCCGCCCGTACTCCACCAGAGACCCAACGAGAAATCGCCGCTCTCCTTCAAATCCCAGTCGTC...GCCGGAACATGCAACCGAGGATCCGAGCTCATCGGAGCCGGTATGGTCGTCAACGATTGGGTCGCA
TRN  10010101110011011
NAM  IF6_ARATH/3-206
ASQ  TRLQYDNNNCEIGVFSKLTNAYCLVSATsASANFFTGYESKLKGVIPIVTTSIGGSGTIGSLCVGNKNGLLLSHTITDQELQHLRDSLPDE-VVVQRIEEP--ICALGNAIACNDYVALVHPKLEKDTEEIISDVLGVE-VYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQVPLV.AGTVNRGSQVISAGLTVNDWTA
DSQ  ACTCGTCTTCAATATGATAACAATAATTGCGAAATTGGTGTCTTTTCCAAACTCACAAATGCTTATTGTCTCGTTTCCGCAACAtctGCCTCCGCAAACTTCTTCACTGGTTATGAGTCGAAGTTAAAAGGTGTTATCCCAATTGTTACTACTTCCATAGGAGGATCAGGGACTATTGGTAGTCTATGTGTCGGAAACAAAAACGGACTTCTTCTGTCTCACACCATTACAGACCAAGAGCTTCAACATTTGAGAGATAGTTTGCCTGATGAA---GTTGTAGTCCAACGAATTGAAGAACCT------ATATGTGCACTTGGAAACGCTATAGCTTGCAATGACTATGTCGCGCTTGTGCATCCAAAGCTCGAGAAAGACACCGAAGAGATAATAAGTGATGTTCTTGGTGTTGAA---GTTTATCGCCAAACCATTGCGAATAACGAACTTGTGGGAAGTTATTGTTCTTTATCCAATAATGGTGGAATGGTTCACTCAAATACCAACGTGGAAGAAATGGTCGAGCTAGCGAATCTTGTTCAGGTGCCTTTGGTT...GCAGGAACCGTGAACCGTGGCAGCCAAGTTATATCCGCGGGTTTGACTGTGAACGATTGGACCGCT
TRN  10010101100011000
NAM  IF6_METJA/5-207
ASQ  IRKYFSGIP-TIGVLALTTEEITLLPIF.LDKDDVNEVSEVLE--TKCLQTNIGGSSLVGSLSVANKYGLLLPKIVEDEELDRIKNFLKENNLDLNVEIIKSKNTALGNLILTNDKGALISPEL-KDFKKDIEDSLNVE-VEIGTIAELPTVGSNAVVTNKGCLTHPLVEDDELEFLKSLFKVEYIgKGTANKGTTSVGACIIANSKGA
DSQ  ATAAGAAAATACTTCTCAGGAATTCCC---ACAATTGGTGTATTGGCATTAACAACTGAAGAAATAACTCTATTACCAATTTTT...CTTGACAAAGATGATGTTAATGAAGTATCTGAGGTTTTAGAA------ACAAAATGCCTCCAAACTAATATTGGAGGCAGTTCATTAGTTGGTTCTTTATCAGTAGCAAATAAATATGGGCTATTACTACCAAAAATAGTTGAAGATGAAGAATTAGATAGAATAAAAAATTTCCTAAAAGAAAATAATTTAGATTTAAATGTTGAGATTATAAAATCAAAAAACACGGCTTTAGGTAACTTAATATTAACAAATGACAAAGGAGCTTTAATATCTCCTGAACTA---AAAGATTTTAAGAAGGATATTGAAGATTCCTTAAATGTTGAG---GTTGAGATTGGCACTATTGCTGAACTTCCAACCGTTGGAAGTAATGCCGTTGTAACAAACAAAGGCTGTTTGACCCATCCTTTAGTGGAAGATGATGAACTTGAATTCTTAAAAAGCTTGTTCAAAGTGGAATATATTggtAAAGGAACAGCAAATAAAGGAACCACTTCAGTTGGAGCTTGCATTATAGCAAACTCCAAAGGAGCT
TRN  10010101110011000
NAM  IF6_PYRHO/4-206
ASQ  ERLDFENSP-YLGVFGVATDRVVLIREG.LQEKKLEVIRETLK--VPVIEVSVMKSRIIGTLATGNSNAIILPWYVWDAEIERIKKALSEYGIDMEVVPFRSKYTALGNLILTNDKAALVSAKFSRKEAQEIGEILGVE-VERGVIAGLHAVGSAGVVTNKGGLVHPETSDEELEWLSDLFKVDVY.VGTANMGVPYVGTCMLANSNGV
DSQ  GAGAGGCTCGACTTTGAGAACTCACCG---TATTTGGGTGTATTTGGTGTAGCAACCGATAGGGTAGTCCTTATTAGGGAAGGA...TTACAGGAGAAGAAGTTGGAGGTAATTAGGGAAACCCTTAAG------GTTCCCGTAATAGAGGTCAGCGTAATGAAGTCAAGGATAATAGGAACACTCGCAACCGGGAACTCTAATGCTATAATACTCCCATGGTATGTCTGGGATGCAGAAATCGAGAGGATAAAGAAAGCGTTAAGCGAATACGGAATCGATATGGAAGTCGTCCCATTCAGGAGCAAGTATACGGCCCTGGGAAACTTAATACTGACCAACGATAAAGCGGCCCTAGTTAGTGCTAAGTTTTCCAGGAAGGAGGCCCAGGAGATAGGGGAGATACTAGGAGTTGAA---GTGGAGAGAGGGGTAATAGCTGGCCTTCATGCAGTTGGGAGTGCTGGAGTAGTTACAAATAAGGGAGGCCTCGTCCACCCAGAAACCAGCGATGAGGAATTGGAGTGGCTTTCTGATTTATTTAAAGTTGACGTCTAC...GTTGGAACAGCTAACATGGGAGTTCCCTACGTTGGGACTTGCATGTTGGCTAATTCGAATGGGGTT
TRN  10010101100011000
NAM  IF6_METTH/3-199
ASQ  RRINLSGNP-NLGVYISVTDSVALIPQN.TPEKFEGVLREALE--VEVLKVSISGSSLNGALAVGNSNGFVVSNQAMDREID----ALAAAGVEAVRIPER--FTAVGNLVLANDNGAVASPLLSDDALQVIGDVLEVD-VKVSTLAGLNIVGSMGAATNRGALLNPQASSEEIGIIEDTLGVEAD.VGTVNHGVTLIGACSVANSNGV
DSQ  AGAAGGATCAACCTCAGTGGAAACCCG---AACCTGGGAGTTTACATCTCTGTAACCGACAGTGTGGCCCTGATACCACAGAAC...ACCCCTGAAAAGTTTGAGGGTGTTCTCAGGGAAGCCCTTGAA------GTTGAGGTCCTGAAGGTGTCCATCAGTGGCAGCAGCCTAAACGGTGCCCTTGCCGTGGGCAACTCAAATGGATTCGTGGTCTCAAATCAGGCCATGGACCGTGAAATCGAT------------GCCCTTGCAGCTGCCGGTGTGGAGGCTGTCAGGATCCCTGAAAGG------TTTACTGCAGTCGGTAACCTTGTGCTGGCCAATGACAACGGTGCCGTTGCAAGTCCACTGCTGTCAGATGATGCGCTGCAGGTTATAGGGGATGTGCTTGAGGTTGAC---GTTAAAGTATCCACACTTGCAGGCCTCAACATCGTAGGCTCCATGGGTGCAGCTACCAACCGTGGTGCCCTGCTGAATCCCCAGGCATCATCTGAGGAAATAGGTATCATAGAGGATACCCTGGGAGTGGAGGCCGAC...GTTGGCACAGTCAACCATGGAGTCACACTTATAGGTGCCTGTTCGGTGGCCAACTCAAACGGTGTC
TRN  10010101100011001
NAM  IF6_SULAC/4-203
ASQ  DKLSIFGTD-NIGIYIFTNDKYTIIPKI.DDKEVIEKIQGILK--TEIIQTTISKSVLVGILVTGNNDVILLPRTALADEIKVIK-EQAKD-VRVEVVDIR--PTALGNIILSNTHGALIYQDLSEAEINKVKKALQIDTAIKGTIANIITVGSVAVITDKAGLVHIDATEEELKKLSELFKVKLD.SGTVNFGSVFIRSGLVANRNGV
NAM  IF6_ARCFU/1-195
ASQ  MKVAVNGNP-LIGLYAKVSEEYAVVGVN.-HEPLIDAIQEKLD--VDVIVTKIAGSELVGAMMALNSRGAVVSDQVLSSELR----ELEKS-LDVLVIETP--MTCFGNNLLINDRGGIANPEMESSVVEKVADFMDIE-LVKGTVGGIKTVGMAAVVTNRGGLANPNINEWEAKKLQEVAGVEVL.TGTVNFGTDMVGSGLVANSKGY
DSQ  ATGAAAGTTGCTGTTAACGGCAATCCG---CTGATTGGACTCTACGCCAAGGTGTCTGAGGAGTATGCAGTAGTGGGGGTAAAC...---CACGAGCCTCTGATTGACGCCATTCAGGAGAAGCTTGAT------GTTGATGTTATCGTTACAAAAATAGCCGGTTCCGAGCTTGTTGGGGCGATGATGGCTTTGAACAGCAGGGGGGCAGTGGTTAGTGATCAGGTCCTCTCCAGTGAGCTCAGG------------GAGCTTGAGAAGAGT---CTTGATGTGCTGGTGATTGAGACTCCA------ATGACCTGCTTCGGAAACAATCTGCTGATAAACGATAGGGGTGGGATTGCCAACCCTGAAATGGAGAGCAGTGTGGTGGAGAAGGTGGCCGACTTTATGGACATAGAG---CTTGTCAAGGGGACGGTGGGGGGTATAAAGACCGTCGGCATGGCTGCGGTGGTGACGAACAGGGGTGGGCTTGCAAATCCCAACATAAACGAGTGGGAGGCGAAAAAGCTGCAAGAGGTGGCGGGAGTGGAAGTTTTA...ACCGGAACCGTTAACTTCGGAACGGATATGGTTGGTTCGGGCCTTGTAGCCAACTCAAAAGGATAT
TRN  10010101100011000
//