EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01910 - DUF77)
FAM  PF01910
PID  DUF77
DES  Domain of unknown function DUF77
IPR  IPR002767
ANO  11
ALN  99
AID  0.332227
APH  (((Y230_SYNY3/23-115:0.34222,ECM15_YEAST/6-99:0.76434):0.29982,(YQGV_BACSU/2-90:0.46040,DGLA_STAXY/2-99:0.15685):0.32331):0.11836,((Y1052_METJA/7-98:0.54619,Y1187_METTH/2-96:0.37639):0.23458,(((O67847_AQUAE/48-140:0.36436,Y1933_MYCBO/3-95:0.77939):0.24551,Y1503_CLOPE/4-95:1.17401):0.09452,O29684_ARCFU/1-93:0.71340):0.03765):0.06741,O59567_PYRHO/6-98:0.50137);
ATP  (((Y230_SYNY3/23-115,ECM15_YEAST/6-99),(YQGV_BACSU/2-90,DGLA_STAXY/2-99)),((Y1052_METJA/7-98,Y1187_METTH/2-96),(((O67847_AQUAE/48-140,Y1933_MYCBO/3-95),Y1503_CLOPE/4-95),O29684_ARCFU/1-93)),O59567_PYRHO/6-98);
ATL  7.60008
DNO  11
DLN  297
DID  0.445519
DPH  ((((((Y1187_METTH/2-96:0.34713,O29684_ARCFU/1-93:0.44405):0.16731,(Y1933_MYCBO/3-95:0.67911,O67847_AQUAE/48-140:0.27821):0.22438):0.06265,(Y1503_CLOPE/4-95:0.48061,Y1052_METJA/7-98:0.28974):0.14642):0.05785,O59567_PYRHO/6-98:0.33474):0.11860,(ECM15_YEAST/6-99:0.56162,Y230_SYNY3/23-115:0.41964):0.17423):0.20394,DGLA_STAXY/2-99:0.20662,YQGV_BACSU/2-90:0.36797);
DTP  ((((((Y1187_METTH/2-96,O29684_ARCFU/1-93),(Y1933_MYCBO/3-95,O67847_AQUAE/48-140)),(Y1503_CLOPE/4-95,Y1052_METJA/7-98)),O59567_PYRHO/6-98),(ECM15_YEAST/6-99,Y230_SYNY3/23-115)),DGLA_STAXY/2-99,YQGV_BACSU/2-90);
DTL  5.53531
RID  0.332227
RPH  (((Y230_SYNY3/23-115:0.34222,ECM15_YEAST/6-99:0.76434):0.29982,(YQGV_BACSU/2-90:0.46040,DGLA_STAXY/2-99:0.15685):0.32331):0.11836,((Y1052_METJA/7-98:0.54619,Y1187_METTH/2-96:0.37639):0.23458,(((O67847_AQUAE/48-140:0.36436,Y1933_MYCBO/3-95:0.77939):0.24551,Y1503_CLOPE/4-95:1.17401):0.09452,O29684_ARCFU/1-93:0.71340):0.03765):0.06741,O59567_PYRHO/6-98:0.50137);
RTP  (((Y230_SYNY3/23-115,ECM15_YEAST/6-99),(YQGV_BACSU/2-90,DGLA_STAXY/2-99)),((Y1052_METJA/7-98,Y1187_METTH/2-96),(((O67847_AQUAE/48-140,Y1933_MYCBO/3-95),Y1503_CLOPE/4-95),O29684_ARCFU/1-93)),O59567_PYRHO/6-98);
RTL  7.60008
LNK  DGLA_STAXY/2-99:Q56200:X84332
LNK  ECM15_YEAST/6-99:P35195:Z26494
LNK  O29684_ARCFU/1-93:O29684:AE001065
LNK  O59567_PYRHO/6-98:O59567:BA000001
LNK  O67847_AQUAE/48-140:O67847:AE000771
LNK  Y1052_METJA/7-98:Q58452:U67548
LNK  Y1187_METTH/2-96:O27255:AE000887
LNK  Y1503_CLOPE/4-95:Q46213:U04966
LNK  Y1933_MYCBO/3-95:P67120:BX248340
LNK  Y230_SYNY3/23-115:P72699:D90900
LNK  YQGV_BACSU/2-90:P54499:D84432
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O59567_PYRHO/6-98
ASQ  VIIEFSIVPMGE--VSISKYVAEIIKLVR----DRGVKYQLTPMGTILEVNSIEEGLSIIRDAHELMFKLGSKRVLTTIRIDERRDKARTMEDKVKSVM
DSQ  GTCATAATCGAATTCTCGATAGTTCCCATGGGGGAA------GTTAGCATAAGTAAGTACGTTGCTGAAATAATAAAATTAGTCAGA------------GATAGAGGGGTGAAATATCAGCTGACTCCAATGGGCACGATACTTGAGGTGAATTCTATTGAGGAGGGATTAAGTATTATTAGGGATGCCCATGAGCTGATGTTCAAGTTAGGCAGTAAGAGAGTTCTAACAACTATTAGAATCGATGAGAGAAGAGATAAAGCTAGGACAATGGAGGATAAGGTAAAATCGGTTATG
TRN  10010101100011010
NAM  O29684_ARCFU/1-93
ASQ  MIVEISAVPIGV-GESLSSFVARVIEVLK----EEGVNYSLGPMGTSFEVENFGRLAEILEKVDRALFEAGSPRNYYVIKIDNRAKGGR-MADKVKAVE
DSQ  ATGATTGTTGAAATTTCCGCAGTACCAATTGGTGTT---GGTGAATCTCTCAGCAGCTTCGTTGCGAGGGTTATTGAGGTTCTGAAG------------GAGGAGGGGGTGAATTACAGCCTCGGGCCAATGGGGACCTCCTTTGAGGTGGAAAACTTCGGCAGACTCGCTGAAATCCTTGAGAAGGTTGACAGAGCGCTCTTTGAAGCTGGCTCGCCGAGAAACTACTACGTCATCAAGATAGACAACAGGGCTAAGGGGGGCAGG---ATGGCAGACAAGGTGAAGGCGGTTGAA
TRN  10010101100011011
NAM  Y1052_METJA/7-98
ASQ  VVAEVSIIPLGK-GASVSKYVKKAIEVFK----KYDLKVETNAMGTVLEG-DLDEILKAFKEAHSTVLND-VDRVVSSLKIDERKDKENTIERKLKAIG
DSQ  GTCGTTGCTGAGGTTTCTATAATTCCTTTAGGAAAA---GGAGCAAGTGTTTCAAAGTATGTTAAAAAAGCAATTGAAGTTTTTAAA------------AAGTATGATTTAAAGGTTGAGACAAACGCTATGGGAACTGTATTAGAAGGA---GATTTAGATGAAATTTTAAAAGCTTTTAAAGAAGCACATTCAACAGTTTTAAATGAC---GTTGATAGAGTTGTAAGCAGTTTAAAAATTGATGAAAGGAAAGATAAAGAAAACACAATTGAAAGGAAGTTAAAAGCAATTGGA
TRN  10010101110011000
NAM  Y1187_METTH/2-96
ASQ  ITAELTVIPLGTCSTSLSSYVAAAVEALK----KLNVRYEISGMGTLLEAEDLDELMEAVKAAHEAVLQAGSDRVYTTLKIDDRRDADRGLRDKVESVK
DSQ  ATTACCGCAGAACTCACCGTGATACCCCTGGGTACATGCAGCACCTCCCTCAGCAGCTATGTGGCAGCTGCCGTCGAAGCCCTCAAG------------AAGCTGAATGTGAGGTATGAGATCTCAGGAATGGGGACACTGCTTGAGGCTGAAGACCTTGATGAACTCATGGAGGCTGTCAAGGCCGCACATGAGGCAGTCCTCCAGGCGGGTTCAGATAGGGTCTACACAACCCTCAAGATCGATGATAGAAGGGATGCCGACAGGGGTTTAAGGGATAAGGTTGAATCTGTGAAG
TRN  10010101100011000
NAM  O67847_AQUAE/48-140
ASQ  FLVFVSMTPLGK-GESVSQYVARVVDIID----KSGLPYVLTPMGTIIEGEDWDEVMEVLKKGFEALKEDCN-RISITMKIDYRKGKKGRLIQKVKSVQ
DSQ  TTCTTAGTGTTTGTAAGCATGACTCCGCTCGGAAAA---GGAGAGAGTGTAAGCCAGTACGTTGCGAGGGTTGTTGACATTATAGAT------------AAATCCGGACTGCCTTACGTCCTCACTCCCATGGGAACGATAATAGAGGGAGAAGACTGGGACGAGGTTATGGAAGTTCTAAAAAAGGGCTTTGAGGCACTGAAGGAGGACTGTAAC---CGTATATCTATAACTATGAAAATAGATTACAGGAAAGGAAAGAAGGGAAGGCTTATTCAAAAGGTTAAATCCGTTCAG
TRN  10010101100011010
NAM  Y1933_MYCBO/3-95
ASQ  VLVAFSVTPLGV-GEGVGEIVTEAIRVVR----DSGLPNQTDAMFTVIEGDTWAEVMAVVQRAVEAVAAR-APRVSAVIKVDWRPGVTDAMTQKVATVE
DSQ  GTGCTGGTCGCGTTTTCCGTCACCCCGCTGGGCGTG---GGGGAGGGGGTCGGCGAGATCGTCACCGAAGCGATTCGCGTGGTCCGT------------GATTCCGGCCTGCCGAACCAGACAGATGCCATGTTCACCGTGATCGAAGGCGATACCTGGGCGGAAGTGATGGCCGTCGTGCAGCGCGCGGTGGAGGCCGTGGCCGCTCGG---GCACCGCGAGTCAGCGCGGTGATCAAGGTGGACTGGCGTCCCGGGGTCACCGACGCGATGACCCAGAAGGTCGCTACCGTCGAG
TRN  11011111101111111
NAM  Y230_SYNY3/23-115
ASQ  VIVDLCVVPLGV-GVSVGQYVAACQKVL----AEAGLKHTMHAYGTNIEG-DWDEVFAAVKACHEAVHALGAPRITSSMRFGTRTDRPQTMDEKVKSVE
DSQ  GTGATTGTGGATTTATGTGTTGTGCCCCTGGGTGTG---GGGGTTTCCGTGGGTCAGTATGTGGCCGCTTGCCAGAAAGTACTG------------GCCGAAGCGGGGCTGAAACATACCATGCATGCCTACGGCACCAACATTGAAGGG---GATTGGGACGAAGTTTTTGCCGCAGTTAAGGCTTGCCATGAAGCTGTCCATGCCCTGGGAGCCCCCCGCATCACTTCCAGCATGCGTTTTGGTACCCGCACTGATCGCCCCCAAACCATGGATGAAAAGGTGAAAAGTGTGGAA
TRN  11011101101011010
NAM  YQGV_BACSU/2-90
ASQ  AIADVTIIPIGTETPSVSAYVADVQKILEGYQAEGKIKYQLTPMNTLIEG-ELSDLFAVIQAIHEAPFQK----DCT-----EWQRISVSMTGVTKKRR
DSQ  GCTATCGCAGATGTAACCATTATCCCAATCGGTACGGAAACACCCAGTGTCAGTGCTTACGTAGCCGATGTGCAAAAGATATTAGAAGGATATCAAGCAGAAGGGAAAATCAAATATCAGCTGACACCGATGAATACGCTGATCGAGGGA---GAACTCAGTGACCTTTTTGCAGTTATTCAGGCAATTCACGAAGCGCCATTTCAAAAG------------GATTGCACA---------------GAGTGGCAACGAATATCCGTATCGATGACAGGCGTGACAAAAAAACGACGC
TRN  10010101100011010
NAM  DGLA_STAXY/2-99
ASQ  AIVDVVVIPVGTDGPSVSKYIAEIQTKLKEYKAQGKIDYQLTPMNTLIEG-DLKDLFEVVQAIHELPFDKGLSRVCTNIRIDDRRDKSRNMNEKVKAVE
DSQ  GCTATCGTAGATGTAGTTGTTATACCGGTCGGAACAGATGGACCGAGCGTGAGTAAATATATTGCTGAAATTCAAACTAAATTAAAAGAATATAAAGCACAGGGGAAAATTGATTATCAATTAACGCCAATGAATACATTAATTGAAGGT---GATTTAAAGGATTTATTTGAAGTTGTGCAAGCAATTCATGAATTACCATTTGATAAAGGGCTAAGTCGTGTATGTACTAATATTAGAATTGATGATCGCCGAGATAAGTCGCGTAATATGAACGAGAAAGTGAAGGCTGTAGAA
TRN  10010101110011010
NAM  ECM15_YEAST/6-99
ASQ  CLADVCMVPIGTDSASISDFVALIEKKIR----ESPLKSTLHSAGTTIEG-PWDDVMGLIGEIHEYGHEKGYVRVHTDIRVGTRTDKHQTAQDKIDVVL
DSQ  TGTTTAGCGGACGTGTGTATGGTCCCTATTGGCACCGACTCTGCTAGTATTTCTGATTTTGTTGCACTCATTGAAAAAAAAATCAGA------------GAAAGCCCATTAAAGAGCACTTTACACAGTGCAGGAACAACAATTGAAGGG---CCTTGGGATGATGTGATGGGTTTGATTGGCGAAATCCATGAATACGGTCATGAGAAAGGATATGTTAGAGTACACACTGATATTCGTGTTGGGACTAGAACTGATAAGCACCAAACTGCTCAAGATAAGATCGATGTTGTTTTA
TRN  10010101110011010
NAM  Y1503_CLOPE/4-95
ASQ  CNVSLQILPSVE-DSRLYEVVDKVIEYIE----STGVKFEVGPMETTMEG-KIDDLLEIVKKSQEICIEEGAGRVISIVKIDYKKGGVT-MDEKVGKYR
DSQ  TGTAATGTTAGTTTACAAATACTTCCCTCAGTAGAG---GATTCAAGGCTTTATGAAGTTGTTGATAAGGTTATTGAATATATAGAA------------TCAACAGGAGTAAAGTTTGAGGTTGGTCCTATGGAAACTACCATGGAAGGA---AAAATTGATGATTTACTAGAAATTGTGAAAAAATCTCAAGAAATATGCATAGAAGAAGGTGCTGGAAGAGTTATATCAATAGTTAAAATTGATTATAAAAAAGGCGGAGTAACC---ATGGATGAAAAGGTTGGAAAATATAGA
TRN  10010101110011000
//