EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01876 - RNase_P_p30)
FAM  PF01876
PID  RNase_P_p30
DES  RNase P subunit p30
IPR  IPR002738
ANO  12
ALN  159
AID  0.221408
APH  (((Q9UXC8_SULSO/34-173:1.42147,Q9YC00_AERPE/71-219:0.75565):0.38493,(RNP3_METTH/69-220:0.44782,((RNP3_METJA/54-205:0.64821,RNP3_ARCFU/29-174:1.00371):0.09343,(RNP3_PYRHO/52-202:0.07013,RNP3_PYRAB/52-203:0.29348):0.63337):0.21059):0.55107):0.72361,Q9TYZ2_CAEEL/145-296:0.96111,((RNP3_SCHPO/65-212:0.42493,RPP1_YEAST/81-228:0.73836):0.30163,(RP30_MOUSE/74-224:0.41751,Q9VPM0_DROME/77-226:0.83909):0.20270):0.08015);
ATP  (((Q9UXC8_SULSO/34-173,Q9YC00_AERPE/71-219),(RNP3_METTH/69-220,((RNP3_METJA/54-205,RNP3_ARCFU/29-174),(RNP3_PYRHO/52-202,RNP3_PYRAB/52-203)))),Q9TYZ2_CAEEL/145-296,((RNP3_SCHPO/65-212,RPP1_YEAST/81-228),(RP30_MOUSE/74-224,Q9VPM0_DROME/77-226)));
ATL  11.2029
DNO  12
DLN  477
DID  0.372208
DPH  (((Q9YC00_AERPE/71-219:0.65437,((((RNP3_SCHPO/65-212:0.43494,RPP1_YEAST/81-228:0.55270):0.20580,(RP30_MOUSE/74-224:0.43552,Q9VPM0_DROME/77-226:0.55663):0.04537):0.12772,Q9TYZ2_CAEEL/145-296:0.66617):0.21167,Q9UXC8_SULSO/34-173:0.70323):0.24841):0.27576,(RNP3_METJA/54-205:0.51068,(RNP3_ARCFU/29-174:0.69007,RNP3_METTH/69-220:0.45550):0.05875):0.08745):0.30789,RNP3_PYRHO/52-202:0.12685,RNP3_PYRAB/52-203:0.28796);
DTP  (((Q9YC00_AERPE/71-219,((((RNP3_SCHPO/65-212,RPP1_YEAST/81-228),(RP30_MOUSE/74-224,Q9VPM0_DROME/77-226)),Q9TYZ2_CAEEL/145-296),Q9UXC8_SULSO/34-173)),(RNP3_METJA/54-205,(RNP3_ARCFU/29-174,RNP3_METTH/69-220))),RNP3_PYRHO/52-202,RNP3_PYRAB/52-203);
DTL  7.64344
RID  0.221408
RPH  (((Q9UXC8_SULSO/34-173:1.42147,Q9YC00_AERPE/71-219:0.75565):0.38493,(RNP3_METTH/69-220:0.44782,((RNP3_METJA/54-205:0.64821,RNP3_ARCFU/29-174:1.00371):0.09343,(RNP3_PYRHO/52-202:0.07013,RNP3_PYRAB/52-203:0.29348):0.63337):0.21059):0.55107):0.72361,Q9TYZ2_CAEEL/145-296:0.96111,((RNP3_SCHPO/65-212:0.42493,RPP1_YEAST/81-228:0.73836):0.30163,(RP30_MOUSE/74-224:0.41751,Q9VPM0_DROME/77-226:0.83909):0.20270):0.08015);
RTP  (((Q9UXC8_SULSO/34-173,Q9YC00_AERPE/71-219),(RNP3_METTH/69-220,((RNP3_METJA/54-205,RNP3_ARCFU/29-174),(RNP3_PYRHO/52-202,RNP3_PYRAB/52-203)))),Q9TYZ2_CAEEL/145-296,((RNP3_SCHPO/65-212,RPP1_YEAST/81-228),(RP30_MOUSE/74-224,Q9VPM0_DROME/77-226)));
RTL  11.2029
LNK  Q9TYZ2_CAEEL/145-296:Q9TYZ2:AF100660
LNK  Q9UXC8_SULSO/34-173:Q9UXC8:Y18930
LNK  Q9VPM0_DROME/77-226:Q9VPM0:AE003590
LNK  Q9YC00_AERPE/71-219:Q9YC00:BA000002
LNK  RNP3_ARCFU/29-174:O27967:AE000944
LNK  RNP3_METJA/54-205:Q58539:U67556
LNK  RNP3_METTH/69-220:O26784:AE000848
LNK  RNP3_PYRAB/52-203:Q9UXX7:AJ248288
LNK  RNP3_PYRHO/52-202:O59543:AP000007
LNK  RNP3_SCHPO/65-212:P87120:Z95395
LNK  RP30_MOUSE/74-224:O88796:U95123
LNK  RPP1_YEAST/81-228:P38786:U95757
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q9YC00_AERPE/71-219
ASQ  YRRGYVEASTRR--DVRRAAEKLAGVVDFIVVKPLTLEAARYAAANKR.VHIIRVDGSN--L--WAADRGTAEIMAQRGWgALEVSLRNLTLNPGSPAA--WRALAVVLRRSFAY-GVHVFLASDAEEPHELWSPYSGASLAALLGVPWSHAMLYNSEE
DSQ  TATAGGCGTGGCTATGTTGAGGCTTCGACGAGGCGG------GACGTGAGAAGAGCGGCTGAGAAGCTCGCCGGGGTTGTCGACTTCATAGTGGTGAAGCCCCTCACACTTGAGGCGGCTAGATACGCTGCTGCCAACAAGAGG...GTCCACATAATTAGGGTGGACGGGTCAAAC------CTA------TGGGCGGCGGACAGGGGTACGGCTGAGATAATGGCGCAGAGGGGCTGGggcGCCTTGGAAGTATCACTCCGAAACCTCACATTAAACCCGGGTTCTCCAGCGGCC------TGGAGGGCTCTGGCAGTGGTCCTAAGAAGGAGCTTTGCCTAC---GGGGTCCACGTATTTCTGGCGAGCGACGCCGAAGAGCCTCATGAGCTGTGGAGCCCCTACTCCGGCGCCTCGTTAGCAGCCCTGCTAGGCGTGCCGTGGAGCCATGCCATGCTCTATAACAGCGAGGAG
TRN  10010101100011000
NAM  RNP3_ARCFU/29-174
ASQ  GCGIVIRANSPE--ELRKKLRGVKRRAIVGII--GKEAVCREAVMRRR.VDVILD-WED-----RELDYATLKLAAEKDV.AIELSLSKFLRTEGYKRMHLFERLRQEIMVIRKF-DVPFIVTTAAENQYELRTRKQVETFFKFFGAEIPKARLYAQRL
DSQ  GGCTGTGGAATTGTTATCAGGGCGAACTCTCCGGAG------GAACTGAGAAAAAAGCTCAGAGGCGTTAAAAGGAGGGCCATAGTCGGCATTATC------GGTAAGGAGGCTGTTTGCAGAGAGGCTGTGATGAGAAGAAGG...GTTGACGTTATTCTTGAC---TGGGAGGAC---------------AGGGAGCTGGATTACGCAACGCTGAAGCTCGCTGCCGAGAAGGACGTT...GCAATTGAGCTCAGCTTGTCCAAGTTTCTGAGGACTGAGGGCTACAAGAGAATGCACCTCTTCGAAAGGCTCAGGCAGGAAATAATGGTTATCAGGAAATTT---GACGTGCCATTTATAGTTACAACGGCGGCGGAAAACCAATATGAGCTGAGAACGAGAAAGCAGGTCGAAACCTTCTTTAAGTTCTTTGGGGCCGAAATACCGAAGGCGAGATTGTATGCGCAAAGGCTT
TRN  10010101100011011
NAM  RNP3_PYRAB/52-203
ASQ  YGLVAILLVNPRLSIVKEAVQRFK-QNYLIYVESSDLRTIRYSIE-RG.VDAIISPWVGRKD--PGIDHTLARMMAKKGV.ALGFSLRPLLEASPYDKANILKFMRKAWQLTNKY-KVKRFITSSANEKWHIRWPRDLATLGIIIGMEVQQAKAALSTY
DSQ  TATGGATTAGTTGCGATTCTACTTGTAAATCCAAGGCTTTCTATAGTTAAAGAGGCCGTTCAAAGATTTAAG---CAGAATTATCTTATCTACGTGGAAAGCAGTGACCTTAGGACTATTAGATATTCAATCGAA---AGAGGG...GTAGACGCTATAATTTCCCCCTGGGTTGGAAGAAAAGAC------CCAGGAATTGATCACACCCTAGCTAGGATGATGGCCAAGAAAGGTGTA...GCTTTGGGATTTTCCCTTAGACCATTGCTTGAGGCATCACCTTATGATAAAGCAAATATCCTAAAATTCATGAGAAAAGCATGGCAACTTACGAATAAGTAT---AAGGTCAAGAGATTCATAACAAGTTCAGCCAACGAGAAATGGCACATTAGATGGCCAAGAGATCTGGCAACTTTAGGTATAATAATTGGGATGGAAGTTCAACAAGCAAAAGCTGCACTTTCAACATAT
TRN  10010101100011000
NAM  RNP3_PYRHO/52-202
ASQ  YGKVAILLSNPKPSLVRDTVQKFK--SYLIYVESNDLRVIRYSIE-KG.VDAIISPWVNRKD--PGIDHVLAKLMVKKNV.ALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKY-KVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMY
DSQ  TATGGAAAAGTTGCGATACTACTTTCCAACCCCAAGCCTTCACTTGTGAGGGATACAGTTCAGAAGTTTAAA------AGCTATCTAATATACGTTGAAAGCAACGACCTTAGGGTAATAAGGTACTCAATTGAG---AAGGGA...GTTGACGCAATAATTTCCCCCTGGGTAAATAGGAAGGAT------CCCGGGATAGATCATGTTCTTGCAAAGCTAATGGTTAAGAAGAACGTA...GCCTTGGGATTCTCATTAAGACCCCTGTTATACTCAAACCCTTATGAGAGAGCAAATTTATTGAGATTCATGATGAAGGCATGGAAATTGGTCGAAAAATAT---AAAGTCAGAAGATTTCTAACGAGCTCGGCCCAGGAAAAATGGGATGTAAGATACCCAAGGGACTTAATAAGTTTAGGGGTAGTAATAGGAATGGAAATCCCTCAAGCTAAGGCTTCCATTTCTATGTAC
TRN  10010101100011000
NAM  RNP3_METJA/54-205
ASQ  YSGVKIKTESSK--QLRDKVKKFRNKCHIILIEGGVLKINRAAVELHD.VDILSTPELGRKD--SGIDHVLARLASNHRV.AIELNFKTLLNKDGYERARTLLFFRNNLKLAKKF-DVPVVISTDAENKYQIKNPYDLRAFLNTLVEPLYAKKIMETAY
DSQ  TATTCTGGAGTTAAAATAAAGACAGAAAGTTCTAAA------CAACTAAGGGATAAGGTAAAAAAGTTTAGAAATAAATGCCACATTATATTGATTGAAGGAGGGGTTTTAAAGATAAATAGGGCTGCAGTTGAGTTGCATGAT...GTTGATATATTATCAACTCCTGAACTTGGAAGGAAAGAT------AGTGGAATAGACCATGTATTGGCAAGATTGGCATCAAATCATAGAGTT...GCTATTGAACTCAATTTTAAGACTCTTTTAAATAAAGATGGCTATGAAAGGGCAAGAACTTTGCTATTTTTTAGAAACAACTTAAAATTGGCTAAGAAGTTT---GATGTGCCTGTTGTTATATCTACAGATGCTGAAAATAAATATCAGATAAAAAATCCTTATGATTTAAGAGCTTTTTTAAATACGTTGGTTGAGCCGTTGTATGCAAAAAAGATTATGGAAACTGCCTAT
TRN  10010101110011000
NAM  RNP3_METTH/69-220
ASQ  ARGVMINASDPR--DMRRSVNKFRKKADVIYVSGGNLKVNRAACESRR.VDVLSAPYTSRRD--PGINHVLAREAARNNV.AVELPLADVIGSWLKVRARVLEQFREILKLHRKF-GFPLLLTSRASSIYDLRTPGDIMNLAECFGMESSEAEESLTST
DSQ  GCCAGGGGTGTAATGATAAATGCATCTGACCCCCGT------GATATGAGGAGATCCGTGAATAAATTCAGGAAAAAGGCTGACGTGATCTATGTCTCAGGGGGCAACCTCAAGGTTAACAGGGCCGCATGTGAGAGCAGGCGG...GTTGATGTCCTCTCAGCACCCTACACTTCAAGGAGGGAC------CCTGGCATCAACCATGTCCTCGCAAGGGAGGCTGCAAGAAACAATGTG...GCTGTTGAACTCCCCCTGGCGGACGTCATCGGGTCCTGGCTCAAGGTACGGGCAAGGGTCCTTGAACAGTTCAGGGAGATCCTGAAACTCCACAGAAAGTTC---GGTTTTCCACTGCTCCTCACCAGCAGGGCCTCCTCCATATATGACCTGAGGACTCCCGGCGATATCATGAACCTCGCAGAATGCTTCGGTATGGAGTCCAGTGAGGCAGAGGAATCCCTCACATCAACC
TRN  10010101100011001
NAM  Q9UXC8_SULSO/34-173
ASQ  IKRVTIKVENGNQLKKA-FKKQFVSKEVLVFVKPLSIDALKYAVINKR.VNAVVLDDDNIRI----FKKSMLNLLRSYGK.FVEISLKSS--------SGL----LYNAILFAYKWIPNIIFSSYASSFDEIWSPISKISYLTVLGADEEEAYKFVIIN
DSQ  ATAAAAAGAGTTACTATAAAAGTAGAAAATGGAAATCAACTGAAAAAGGCG---TTTAAGAAGCAATTTGTTAGTAAGGAAGTTTTGGTTTTTGTAAAACCCCTTTCAATAGATGCCTTAAAGTACGCTGTTATCAATAAGAGG...GTTAATGCTGTGGTATTAGATGATGATAATATTAGAATA------------TTTAAGAAAAGCATGCTAAATCTGTTAAGATCTTATGGCAAA...TTTGTTGAGATTTCCCTTAAATCTTCT------------------------AGCGGGTTA------------TTATATAACGCTATACTGTTTGCATATAAATGGATACCTAATATTATTTTCTCCTCGTATGCAAGCTCTTTTGATGAAATCTGGAGTCCAATCTCCAAAATAAGTTATTTGACTGTACTGGGAGCTGATGAAGAGGAAGCTTATAAGTTTGTTATAATAAAT
TRN  10010101100011000
NAM  Q9TYZ2_CAEEL/145-296
ASQ  FSRITFTANEQVVINKV-FIHPTILSYDIVAVRPGEPSVLDTLSRKTElFDIITIDHLEEERRKWLSVSKVMDRIRNDGV.FYEIAYAESLMPAT-RKNTL----FNGRVLIRSLKSKNIIFSSGAETMLDLRSPVDVMNMSLLWGVANNEARKMISGF
DSQ  TTCAGTAGAATTACATTTACTGCAAATGAGCAAGTAGTTATCAATAAAGTT---TTCATTCACCCAACTATTTTGTCCTACGACATCGTTGCCGTTCGCCCGGGCGAGCCATCAGTACTTGACACACTTTCACGAAAAACTGAGcttTTCGATATTATCACAATTGATCATTTGGAGGAAGAAAGGAGAAAATGGTTGTCAGTGTCGAAAGTGATGGATCGAATTCGAAACGATGGAGTT...TTCTACGAAATTGCATATGCAGAGAGTTTGATGCCTGCCACA---CGGAAAAATACATTG------------TTCAACGGCCGAGTCCTGATCAGATCCCTAAAATCGAAGAACATAATCTTCTCATCCGGTGCTGAAACAATGCTTGATCTCCGTTCCCCAGTCGACGTGATGAATATGTCTCTTTTGTGGGGTGTTGCAAATAACGAAGCACGCAAAATGATTTCCGGTTTC
TRN  10010101100011001
NAM  Q9VPM0_DROME/77-226
ASQ  LQRITILYVDVNVAHAM-SVSHNLRKFNLIAGQPKTDAALTHCCTAFN.GDLITFDPVAGSR--LLVNRKAYQVAVRRGM.FFEIKYAPSICDSNNRKDMI----KIAQNYCTKGKSKNVIFSSGAAHEFQLRGPYDVANLAFIFGLSEDQGKNAVDGH
DSQ  CTGCAGAGAATCACCATTCTCTACGTAGACGTCAATGTGGCCCACGCGATG---AGTGTCTCCCATAATCTGCGGAAGTTCAATCTCATCGCTGGCCAACCGAAAACAGATGCCGCCCTGACGCACTGCTGCACTGCCTTCAAT...GGGGACTTGATAACTTTTGATCCTGTGGCTGGGTCCCGA------CTCTTGGTAAACCGAAAAGCATACCAGGTGGCAGTCCGTCGGGGCATG...TTCTTCGAAATTAAATACGCTCCATCTATCTGCGATTCGAATAACAGGAAGGACATGATA------------AAGATCGCCCAGAACTATTGCACCAAAGGGAAGTCCAAGAACGTTATCTTCAGCAGTGGTGCGGCGCACGAATTCCAGCTGAGAGGACCTTACGACGTTGCTAATTTGGCCTTTATCTTCGGCCTATCAGAGGACCAAGGGAAAAATGCTGTGGACGGGCAC
TRN  10010101100011001
NAM  RP30_MOUSE/74-224
ASQ  LTRLTIIVTDPAHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHLD.VDLVCITVTEKLP--FYFKRPPVNVAIERGL.GFELVYGPAIRDATMRRYTI----SNALNLMQICKGKNVILSSAAERPLEIRGPYDVANLGLLFGLSENDGKAAVSTN
DSQ  TTAACTAGATTGACAATTATAGTTACAGATCCAGCTCACTGTAATGTTTTGAGAGCAACTTCGTCAAGGGTCCGGCTGTATGATATTGTTGCAGTCTTTCCAAAGACAGAAAAGCTTTTCCATGTTGCTTGTACACATTTAGAT...GTGGATTTAGTCTGTATAACTGTAACAGAGAAATTACCA------TTTTACTTCAAAAGACCCCCTGTTAATGTGGCAATTGAGCGAGGCCTG...GGCTTTGAACTTGTCTATGGTCCTGCTATCAGAGATGCAACGATGAGAAGGTACACAATC------------TCCAATGCCCTCAATTTGATGCAGATCTGCAAAGGAAAGAATGTAATTCTGTCCAGTGCTGCAGAAAGGCCTTTGGAAATAAGAGGACCATATGACGTGGCAAACTTAGGACTGCTGTTTGGGCTTTCTGAAAATGATGGCAAGGCTGCCGTGTCCACAAAT
TRN  10010101100011000
NAM  RPP1_YEAST/81-228
ASQ  YSRITLIIDDPSKGQSL---SKISQAFDIVAALPISEKGLTLSTTNLD.IDLLTFQYGSRLP--TFLKHKSICSCVNRGV.KLEIVYGYALRDVQARRQFV----SNVRSVIRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAMGDL
DSQ  TACAGCAGGATCACGCTAATTATCGACGATCCATCGAAGGGACAGTCTCTT---------TCCAAGATAAGCCAGGCCTTTGATATTGTAGCAGCATTGCCAATCAGTGAAAAGGGCCTTACTTTATCAACTACCAATCTGGAT...ATTGACTTGTTGACCTTTCAGTACGGGTCGCGCCTGCCT------ACTTTCCTTAAGCATAAAAGCATATGCAGCTGTGTGAACAGAGGAGTA...AAACTTGAAATTGTTTATGGCTATGCTTTGCGTGACGTACAAGCTCGGAGGCAGTTCGTA------------TCCAATGTAAGAAGCGTCATCAGGAGTTCGAGGTCCAGAGGCATTGTTATCGGCAGTGGTGCCATGTCACCACTTGAGTGCCGCAACATATTAGGAGTAACAAGTCTAATCAAGAATTTAGGTCTTCCGAGCGATAGGTGTTCGAAGGCCATGGGAGACCTA
TRN  10010101100011000
NAM  RNP3_SCHPO/65-212
ASQ  YSRITLTIESMPQNKVL---SNVTKEFDILAIRPIGDRLLQQTCSDLE.FDILSIDFTQRLP--FYLKHTFMGLAVSRDI.GIEISYSSGLRDVSNRRNLI----TNATSLVRATRGRGIIVTSETRTPLECRAGFDVINLATFWDLKQDQARKSVGES
DSQ  TATTCTCGAATCACTCTAACAATCGAGTCGATGCCTCAAAACAAAGTGTTG---------TCTAACGTAACAAAAGAATTTGATATCTTAGCCATACGACCAATTGGAGACAGATTGCTGCAACAAACATGCAGTGATTTAGAA...TTTGACATTTTGTCCATAGATTTTACTCAGAGACTTCCC------TTTTATTTGAAACATACATTCATGGGTTTGGCTGTTTCAAGAGACATT...GGTATAGAAATATCATATTCTTCTGGACTTCGAGATGTGTCCAACAGGAGAAATTTGATT------------ACAAACGCTACAAGTCTCGTGAGAGCTACTCGGGGTAGAGGGATAATTGTAACAAGCGAAACTAGAACTCCACTTGAGTGTAGGGCCGGTTTTGATGTAATAAATTTAGCGACTTTTTGGGACTTAAAACAAGACCAAGCTAGAAAATCTGTTGGCGAATCT
TRN  10010101100011000
//