EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01868 - UPF0086)
FAM  PF01868
PID  UPF0086
DES  Domain of unknown function UPF0086
IPR  IPR002730
ANO  6
ALN  92
AID  0.435711
APH  (RNP1_METTH/1-89:0.42587,(RNP1_HALMA/2-88:0.82738,RNP1_PYRHO/37-123:0.37076):0.21401,((RNP1_ARCFU/4-90:1.27779,RNP1_METJA/1-88:0.08100):0.13092,RNP1_METVA/1-92:0.37946):0.02775);
ATP  (RNP1_METTH/1-89,(RNP1_HALMA/2-88,RNP1_PYRHO/37-123),((RNP1_ARCFU/4-90,RNP1_METJA/1-88),RNP1_METVA/1-92));
ATL  3.73494
DNO  6
DLN  276
DID  0.479522
DPH  (((RNP1_METJA/1-88:0.21822,(RNP1_ARCFU/4-90:0.75286,RNP1_PYRHO/37-123:0.40646):0.17006):0.05735,RNP1_METVA/1-92:0.29128):0.17163,RNP1_HALMA/2-88:0.72850,RNP1_METTH/1-89:0.27477);
DTP  (((RNP1_METJA/1-88,(RNP1_ARCFU/4-90,RNP1_PYRHO/37-123)),RNP1_METVA/1-92),RNP1_HALMA/2-88,RNP1_METTH/1-89);
DTL  3.07113
RID  0.435711
RPH  (RNP1_METTH/1-89:0.42587,(RNP1_HALMA/2-88:0.82738,RNP1_PYRHO/37-123:0.37076):0.21401,((RNP1_ARCFU/4-90:1.27779,RNP1_METJA/1-88:0.08100):0.13092,RNP1_METVA/1-92:0.37946):0.02775);
RTP  (RNP1_METTH/1-89,(RNP1_HALMA/2-88,RNP1_PYRHO/37-123),((RNP1_ARCFU/4-90,RNP1_METJA/1-88),RNP1_METVA/1-92));
RTL  3.73494
LNK  RNP1_ARCFU/4-90:O28362:AE000971
LNK  RNP1_HALMA/2-88:P22527:X55311
LNK  RNP1_METJA/1-88:Q57903:U67497
LNK  RNP1_METTH/1-89:O26119:AE000795
LNK  RNP1_METVA/1-92:P14022:X16720
LNK  RNP1_PYRHO/37-123:O59425:AP000007
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RNP1_PYRHO/37-123
ASQ  RVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGD--RIWKVPKDVCIFEFEADD---GTKIKIPGERLVGRPEMRLKKR
DSQ  AGAGTAACGAGAAGAAATATAATTTGGCATGAGCTCATAGGATTGAGGGTCAGGATAGTTGGCTCTACGCATCCAGCATTCGTAGGGATTGAAGGTTACGTAATTGATGAGACCAGAAACATGTTAGTGATAGCTGGAGAC------AGAATTTGGAAAGTCCCTAAGGATGTATGTATATTTGAGTTCGAGGCTGATGAT---------GGGACAAAGATTAAAATACCCGGGGAAAGATTGGTTGGCAGACCTGAGATGAGACTGAAAAAGAGG
TRN  10010101100011010
NAM  RNP1_METJA/1-88
ASQ  MITPHNILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGREVVIPKDIAVFLFQLKG----CKVKVDGRLLIGRPEERLKKK
DSQ  ATGATAACTCCTCACAATATATTAAGGCATGAACTTATAGGGCTTAAAGTAGAGATTGTTGAAGCGAAGAACAAAGCGATGATAGGGATTAAAGGGAAAGTAGTGGATGAAACAAGAAATACATTAGTGATAGAAAAAGAGGATGGTAGGGAAGTAGTAATCCCAAAAGACATTGCAGTGTTTCTCTTTCAACTAAAGGGG------------TGCAAAGTAAAGGTCGATGGGAGATTGCTAATAGGGAGACCAGAAGAGAGATTAAAGAAAAAA
TRN  10010101110011010
NAM  RNP1_METTH/1-89
ASQ  MITPRNIFRHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQ---GELVEIDGRALVARPEERIKKK
DSQ  TTGATAACCCCCAGGAATATTTTCAGGCATGAGCTTATTGGCCTTTCTGTGAGAATAGCCAGGAGTGTTCACAGGGACATTCAGGGAATATCGGGAAGAGTCGTGGATGAAACCAGGAATACCCTTAGAATCGAAATGGATGACGGCCGGGAAATAACGGTTCCAAAGGGAATAGCCGTCTTCCATTTCAGAACACCGCAG---------GGTGAACTTGTTGAGATTGATGGTAGAGCTCTGGTGGCTCGTCCTGAGGAGAGAATAAAGAAGAAA
TRN  10010101100011011
NAM  RNP1_METVA/1-92
ASQ  MKFSQNILRHELVGLNLEIVNSTDKRLISTKGRVINETRNMLVIEKNNGKEITVPKEISIFRFEFSDLDTPKKVDIDGRLLIGRPEDRLKRK
DSQ  ATGAAATTCTCACAAAATATATTGAGACATGAACTAGTTGGATTAAATCTTGAAATTGTAAATTCTACAGATAAAAGATTAATTTCAACAAAAGGGAGAGTAATAAACGAAACCAGAAATATGCTGGTTATCGAAAAAAATAATGGTAAGGAAATTACCGTTCCAAAAGAAATTTCGATATTTCGATTTGAATTTTCAGATTTGGATACCCCTAAAAAGGTAGATATTGATGGAAGACTTCTTATTGGAAGGCCTGAAGACAGGCTAAAAAGGAAA
TRN  10010101100011000
NAM  RNP1_HALMA/2-88
ASQ  PLTPETLPRHELVGLDCEVVAASNPDVIGISGTVVMETTQMLTLEGAD-RVWHVPKDSATFAFDLST----ETVLVDGDRLVARPARRTENT
DSQ  CCACTAACACCCGAGACGCTCCCACGACACGAACTCGTCGGCCTCGACTGCGAGGTCGTCGCGGCGTCCAATCCGGATGTCATCGGTATCAGCGGAACTGTCGTCATGGAGACGACACAGATGCTGACACTCGAGGGGGCCGAC---CGGGTGTGGCACGTGCCGAAGGACAGCGCGACGTTCGCGTTCGACCTGTCGACC------------GAGACGGTTCTCGTCGACGGCGACCGCCTCGTTGCCCGTCCCGCTCGTCGCACAGAGAACACA
TRN  11011111101111111
NAM  RNP1_ARCFU/4-90
ASQ  RLQGVELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEK-GLKVVAKRGRTFRVWYKG----KIMRIKGDLINFRPEDRIKRG
DSQ  AGGCTACAGGGTGTAGAGCTGATAGCGAGGGACTGGATTGGCCTGATGGTGGAAGTGGTGGAGAGTCCAAACCACAGCGAAGTGGGGATAAAGGGAGAAGTGGTTGATGAGACTCAGAACACGCTCAAAATAATGACTGAAAAA---GGTTTAAAAGTCGTGGCGAAGAGAGGTAGAACCTTCAGAGTGTGGTATAAGGGT------------AAAATCATGCGGATAAAGGGTGATCTGATAAATTTCAGGCCGGAGGATAGGATAAAGAGAGGT
TRN  10010101100011010
//