EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01848 - HOK_GEF)
FAM  PF01848
PID  HOK_GEF
DES  Hok/gef family
IPR  IPR000021
ANO  7
ALN  50
AID  0.367174
APH  ((HOKE_ECOLI/1-50:0.39884,SRNB_ECOLI/19-68:0.62799):0.16122,(PND1_ECOLI/1-50:0.39939,HOKA_ECOLI/1-50:0.36025):0.07506,((HOK_ECOLI/3-52:0.33766,HOKB_ECOLI/1-49:0.33802):0.25623,HOKC_ECOLI/2-50:0.49692):0.36574);
ATP  ((HOKE_ECOLI/1-50,SRNB_ECOLI/19-68),(PND1_ECOLI/1-50,HOKA_ECOLI/1-50),((HOK_ECOLI/3-52,HOKB_ECOLI/1-49),HOKC_ECOLI/2-50));
ATL  3.81732
DNO  7
DLN  150
DID  0.499074
DPH  (((PND1_ECOLI/1-50:0.33700,HOKA_ECOLI/1-50:0.25867):0.14310,(HOKC_ECOLI/2-50:0.38372,(HOKB_ECOLI/1-49:0.27537,HOK_ECOLI/3-52:0.31242):0.11039):0.20831):0.15978,HOKE_ECOLI/1-50:0.26426,SRNB_ECOLI/19-68:0.39027);
DTP  (((PND1_ECOLI/1-50,HOKA_ECOLI/1-50),(HOKC_ECOLI/2-50,(HOKB_ECOLI/1-49,HOK_ECOLI/3-52))),HOKE_ECOLI/1-50,SRNB_ECOLI/19-68);
DTL  2.84329
RID  0.367174
RPH  ((HOKE_ECOLI/1-50:0.39884,SRNB_ECOLI/19-68:0.62799):0.16122,(PND1_ECOLI/1-50:0.39939,HOKA_ECOLI/1-50:0.36025):0.07506,((HOK_ECOLI/3-52:0.33766,HOKB_ECOLI/1-49:0.33802):0.25623,HOKC_ECOLI/2-50:0.49692):0.36574);
RTP  ((HOKE_ECOLI/1-50,SRNB_ECOLI/19-68),(PND1_ECOLI/1-50,HOKA_ECOLI/1-50),((HOK_ECOLI/3-52,HOKB_ECOLI/1-49),HOKC_ECOLI/2-50));
RTL  3.81732
LNK  HOKA_ECOLI/1-50:P37305:U00096
LNK  HOKB_ECOLI/1-49:P77494:U00096
LNK  HOKC_ECOLI/2-50:P22982:X17311
LNK  HOK_ECOLI/3-52:P11895:X05813
LNK  HOKE_ECOLI/1-50:P77091:U00096
LNK  PND1_ECOLI/1-50:P11902:X12833
LNK  SRNB_ECOLI/19-68:P13970:M16168
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SRNB_ECOLI/19-68
ASQ  FMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
DSQ  TTTATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCTACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAG
TRN  10010101100011000
NAM  HOKE_ECOLI/1-50
ASQ  MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK
DSQ  ATGCTGACGAAATATGCCCTTGCGGCAGTCATAGTGCTGTGTTTAACGGTGCTGGGATTTACGCTTCTGGTCGGAGACTCGCTGTGTGAGTTTACGGTGAAGGAACGTAATATTGAGTTTAAGGCTGTTCTCGCTTACGAACCGAAGAAG
TRN  10010101100011010
NAM  HOKA_ECOLI/1-50
ASQ  MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
DSQ  ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTCACTGTGTGAATTGCATATTAAACAGGAGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAG
TRN  10010101100011000
NAM  PND1_ECOLI/1-50
ASQ  MPQRTFLMMLIVVCVTILCFVWMVRDSLCGFRIEQGNTVLVATLAYEVKR
DSQ  ATGCCACAACGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATACTGTGTTTTGTCTGGATGGTGAGGGATTCGCTTTGCGGATTTCGTATCGAGCAGGGAAATACGGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGT
TRN  10010101100011010
NAM  HOKC_ECOLI/2-50
ASQ  KQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE-
DSQ  AAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAAAGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAG---
TRN  10010101100011011
NAM  HOKB_ECOLI/1-49
ASQ  MKHNPLVVCLLIICITILTFTLLTRQTLYELRFRDGDKEVAALMACTSR-
DSQ  ATGAAGCACAACCCTCTGGTGGTGTGTCTGCTCATTATCTGCATTACGATTCTGACATTCACACTCCTGACCCGACAAACGCTCTACGAACTGCGGTTCCGGGACGGTGATAAGGAGGTTGCTGCGCTCATGGCCTGCACGTCCAGG---
TRN  10010101100011011
NAM  HOK_ECOLI/3-52
ASQ  LPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
DSQ  CTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAG
TRN  10010101100011011
//