EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01767 - Birna_VP3)
FAM  PF01767
PID  Birna_VP3
DES  Birnavirus VP3 protein
IPR  IPR002663
ANO  6
ALN  258
AID  0.427949
APH  (POLS_IPNVN/723-939:0.09624,(POLS_IPNVJ/723-939:0.04825,O55651_9VIRU/723-939:0.05025):0.05977,((POLS_IBDVP/720-956:0.02042,POLG_IBDVO/739-975:0.05029):0.31109,Q96724_9VIRU/727-984:2.67567):0.87900);
ATP  (POLS_IPNVN/723-939,(POLS_IPNVJ/723-939,O55651_9VIRU/723-939),((POLS_IBDVP/720-956,POLG_IBDVO/739-975),Q96724_9VIRU/727-984));
ATL  4.19098
DNO  6
DLN  774
DID  0.511943
DPH  ((POLS_IPNVN/723-939:0.12364,((POLS_IBDVP/720-956:0.03674,POLG_IBDVO/739-975:0.12190):0.27958,Q96724_9VIRU/727-984:1.55363):0.51030):0.05784,POLS_IPNVJ/723-939:0.06170,O55651_9VIRU/723-939:0.09897);
DTP  ((POLS_IPNVN/723-939,((POLS_IBDVP/720-956,POLG_IBDVO/739-975),Q96724_9VIRU/727-984)),POLS_IPNVJ/723-939,O55651_9VIRU/723-939);
DTL  2.8443
RID  0.427949
RPH  (POLS_IPNVN/723-939:0.09624,(POLS_IPNVJ/723-939:0.04825,O55651_9VIRU/723-939:0.05025):0.05977,((POLS_IBDVP/720-956:0.02042,POLG_IBDVO/739-975:0.05029):0.31109,Q96724_9VIRU/727-984:2.67567):0.87900);
RTP  (POLS_IPNVN/723-939,(POLS_IPNVJ/723-939,O55651_9VIRU/723-939),((POLS_IBDVP/720-956,POLG_IBDVO/739-975),Q96724_9VIRU/727-984));
RTL  4.19098
LNK  O55651_9VIRU/723-939:O55651:AB011440
LNK  POLG_IBDVO/739-975:P27276:M66722
LNK  POLS_IBDVP/720-956:P25220:D00868
LNK  POLS_IPNVJ/723-939:P05844:M18049
LNK  POLS_IPNVN/723-939:P22495:D00701
LNK  Q96724_9VIRU/727-984:Q96724:U60650
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q96724_9VIRU/727-984
ASQ  NPFMNTNPFLEELDQPIPSNAAKPISEETRDLFLSDGQTIPSSQEKIATIHEYLLEHKELEEAMFSLISQGRGRSLINMVVKSALNIETQSREVTGERRQRLERKLRNLENQGIYVDESKIMSRGRISKEDTELAMRIARKNQKDAKLRRIYSNNASIQESYTVDDFVSYWMEQESLPTGIQIAMWLKGDDWSQPIPPRVQRRHYDSYIMMLGPSPTQEQADAVKDLVDDIYDRNQGKGPSQEQARELSHAVRRLISH
DSQ  AACCCATTCATGAACACGAACCCATTCCTGGAAGAGTTGGACCAGCCGATACCAAGCAACGCTGCAAAGCCAATCTCCGAGGAGACTCGGGATTTGTTTCTATCGGACGGTCAAACCATCCCAAGCTCTCAAGAGAAGATTGCCACAATACACGAGTACCTCCTGGAACACAAGGAGTTAGAGGAGGCAATGTTCAGCTTGATAAGCCAAGGGAGAGGCCGGTCTCTTATCAACATGGTAGTAAAAAGCGCTCTGAACATCGAAACCCAGTCTCGAGAAGTCACCGGCGAAAGAAGGCAAAGACTAGAACGAAAACTTCGAAACTTGGAAAATCAAGGGATATATGTTGATGAGAGCAAAATAATGTCAAGAGGAAGAATATCGAAAGAAGACACGGAACTAGCAATGAGGATTGCTCGGAAGAACCAAAAGGATGCAAAGTTACGGAGAATCTATAGCAATAACGCCTCGATCCAAGAGTCGTACACTGTGGATGACTTTGTATCCTATTGGATGGAGCAGGAGTCATTGCCTACTGGCATACAAATCGCAATGTGGTTAAAGGGTGACGATTGGTCCCAGCCAATACCACCTCGTGTCCAAAGACGACACTATGACAGCTACATTATGATGCTTGGGCCGTCACCAACCCAAGAACAAGCCGATGCTGTTAAGGACCTTGTCGACGACATATACGACAGAAATCAAGGGAAGGGGCCATCCCAGGAACAAGCTCGGGAATTAAGTCATGCTGTCCGCAGGCTTATTTCGCAC
TRN  10010101100011000
NAM  POLS_IPNVN/723-939
ASQ  IKYLG-----ELMASNASGMDEELQRLLNATMARAKEVQDAEIYK-LLKLMAWTRKNDLTDHMYEWSKEDPDALKFGKLISTPP-----------KHPEKP----------KGPDQHHAQEARATRISLDAVRAGADFATPEWVALNNYRGPSPGQ-----------FKYYLITGREPEPGDEYEDYIKQPIVKPTDMNKIRRLANS---VYGLPHQEPAPEEFYDAVAAVFAQNGGRGPDQDQMQDLRELARQMKRR
DSQ  ATCAAGTACCTGGGA---------------GAGCTGATGGCATCAAATGCATCCGGGATGGACGAGGAACTGCAACGCCTCCTGAACGCCACAATGGCACGGGCCAAAGAAGTCCAGGACGCCGAGATCTACAAA---CTTCTTAAGCTCATGGCATGGACCAGAAAGAACGACCTCACCGACCACATGTACGAGTGGTCAAAAGAGGACCCCGATGCACTAAAGTTCGGAAAGCTCATCAGCACGCCACCA---------------------------------AAGCACCCTGAGAAGCCC------------------------------AAAGGACCAGACCAACACCACGCCCAAGAGGCGAGAGCCACCCGCATATCACTGGACGCCGTGAGAGCCGGGGCGGACTTCGCCACACCGGAATGGGTCGCGCTGAACAACTACCGCGGCCCATCTCCCGGGCAG---------------------------------TTCAAGTACTACCTGATCACTGGACGAGAACCAGAACCAGGCGACGAGTACGAGGACTACATAAAACAACCCATTGTGAAACCGACCGACATGAACAAAATCAGACGTCTAGCCAACAGT---------GTGTACGGCCTCCCACACCAGGAACCAGCACCAGAGGAGTTCTACGATGCAGTTGCAGCTGTATTCGCACAGAACGGAGGCAGAGGTCCCGACCAGGACCAAATGCAAGACCTCAGGGAGCTCGCAAGACAGATGAAACGACGA
TRN  10010101100011001
NAM  O55651_9VIRU/723-939
ASQ  IKYLG-----ELMRTTASGMDEELQKLLHATMARAKEVKDAEVFK-LLKLMSWTRKNGLTDHMYEWSKEDPEAVKFGKLISTPP-----------KHQEKP----------KGPDQHTAQEAKAVRISLDAVKAGADFASPDWIAENGYRGPSPGQ-----------FKYYVITGRVPDPRDEYEDYVRKPITRPTDMDKIRRLANG---VYGLPHQEPAPEEFYQAVVEIFAENGGRGPDQDQMQDLRDLARQMKRR
DSQ  ATCAAGTACCTGGGG---------------GAACTAATGAGAACAACTGCATCAGGGATGGACGAAGAGCTGCAGAAGCTGCTGCACGCCACCATGGCCAGAGCAAAAGAGGTGAAAGACGCCGAAGTCTTCAAA---CTTCTCAAGCTGATGTCCTGGACCAGGAAGAACGGGCTCACCGACCACATGTATGAATGGTCAAAAGAGGACCCTGAAGCAGTCAAATTTGGCAAACTCATCAGCACACCACCA---------------------------------AAACACCAAGAGAAGCCA------------------------------AAAGGACCCGACCAGCACACGGCACAGGAGGCAAAAGCCGTCCGGATCTCACTAGATGCAGTGAAAGCAGGAGCAGACTTTGCCTCCCCAGACTGGATCGCGGAGAATGGATACCGCGGTCCATCACCAGGCCAG---------------------------------TTCAAGTACTACGTCATCACAGGGCGCGTCCCAGACCCACGAGACGAGTACGAGGACTACGTGCGAAAACCAATAACAAGACCCACGGACATGGACAAAATCAGACGCTTAGCCAACGGT---------GTGTACGGACTTCCCCACCAAGAACCTGCACCAGAGGAATTCTACCAAGCGGTAGTCGAGATCTTCGCAGAAAATGGAGGACGAGGACCAGATCAAGACCAGATGCAAGACCTGAGGGACTTGGCCCGGCAGATGAAACGACGA
TRN  10010101100011000
NAM  POLS_IPNVJ/723-939
ASQ  IKYLG-----QLMRTTASGMDAELQGLLQATMARAKEVKDAEVFK-LLKLMSWTRKNDLTDHMYEWSKEDPDAIKFGRLVSTPP-----------KHQEKP----------KGPDQHTAQEAKATRISLDAVKAGADFASPEWIAENNYRGPSPGQ-----------FKYYMITGRVPNPGEEYEDYVRKPITRPTDMDKIRRLANS---VYGLPHQEPAPDDFYQAVVEVFAENGGRGPDQDQMQDLRDLARQMKRR
DSQ  ATCAAGTACCTGGGC---------------CAGCTGATGAGAACAACTGCATCAGGGATGGACGCAGAACTGCAGGGGCTGCTGCAGGCCACCATGGCCAGAGCAAAAGAAGTGAAGGACGCCGAAGTGTTCAAA---CTTCTGAAACTCATGTCATGGACAAGAAAGAACGACCTCACAGATCACATGTATGAGTGGTCAAAGGAGGATCCTGATGCAATCAAATTTGGCAGGCTCGTCAGCACCCCCCCA---------------------------------AAACACCAAGAGAAGCCA------------------------------AAAGGACCTGACCAGCACACCGCCCAGGAGGCAAAGGCCACCAGGATTTCACTGGACGCCGTCAAAGCCGGCGCAGACTTTGCCTCCCCAGAGTGGATCGCGGAGAACAACTACCGCGGCCCATCCCCAGGCCAG---------------------------------TTCAAGTACTACATGATAACGGGCAGAGTCCCAAACCCCGGAGAAGAGTACGAGGACTATGTGCGAAAACCGATAACCCGACCAACCGACATGGACAAAATCAGACGCCTAGCCAACAGT---------GTCTACGGCCTGCCCCACCAAGAACCCGCACCAGACGACTTCTACCAGGCAGTCGTCGAGGTGTTCGCAGAAAACGGGGGAAGAGGGCCCGACCAAGACCAAATGCAAGACCTGAGGGACTTGGCAAGGCAGATGAAACGACGA
TRN  10010101100011001
NAM  POLG_IBDVO/739-975
ASQ  LPYLPPTAGRQFHLALAASEFKETPELEDAVRAMDAAANADPLFRSALQVFMWLEENGIVTDMANFALSDPNAHRMKNFLANAPQ-------AGSKSQRAKYGTAGYGVEARGPTPEEAQRAKDARISKKMETMGIYFATPEWVALNGHRGPSPGQ-----------LKYWQNTREIPEPNEDYPDYVHAEKSRLASEEQILRAATS---IYGAPGQAEPPQAFIDEVARVYETNHGRVPNQEQMKDLLLTAMEMKHR
DSQ  CTACCCTACCTTCCACCGACAGCAGGACGCCAATTCCACCTAGCCCTGGCAGCATCTGAGTTCAAAGAGACTCCCGAACTTGAGGACGCTGTACGTGCAATGGATGCCGCTGCAAACGCTGACCCATTGTTCCGCTCAGCACTCCAAGTCTTCATGTGGCTGGAAGAAAACGGGATTGTGACTGACATGGCCAACTTTGCCCTCAGTGACCCAAACGCACACAGGATGAAGAATTTCCTAGCCAACGCTCCCCAG---------------------GCCGGGAGCAAGTCACAGAGAGCCAAGTATGGCACGGCAGGCTACGGAGTGGAGGCTCGAGGCCCCACACCAGAAGAGGCACAGAGGGCAAAAGACGCGCGGATCTCCAAGAAGATGGAAACAATGGGCATCTACTTCGCAACGCCAGAATGGGTGGCACTCAATGGGCATCGAGGGCCAAGTCCCGGCCAA---------------------------------CTCAAGTATTGGCAAAACACACGAGAGATACCGGAACCCAACGAGGACTATCCAGACTACGTGCACGCGGAGAAGAGCCGGTTGGCATCAGAAGAACAGATCTTAAGGGCAGCCACGTCG---------ATCTACGGGGCTCCAGGACAGGCTGAACCACCCCAGGCCTTCATAGACGAAGTAGCCAGGGTCTATGAAACAAACCACGGGCGTGTCCCAAACCAAGAGCAGATGAAGGACCTGCTCTTGACTGCGATGGAGATGAAGCATCGC
TRN  10010101100011000
NAM  POLS_IBDVP/720-956
ASQ  LPYLPPNAGRQYHLAMAASEFKETPELESAVRAMEAAANVDPLFQSALSVFMWLEENGIVTDMANFALSDPNAHRMRNFLANAPQ-------AGSKSQRAKYGTAGYGVEARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGHRGPSPGQ-----------LKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQILRAATS---IYGAPGQAEPPQAFIDEVAKVYEINHGRGPNQEQMKDLLLTAMEMKHR
DSQ  CTACCATACCTTCCACCCAATGCAGGACGCCAGTACCACCTTGCCATGGCTGCATCAGAGTTCAAAGAGACCCCCGAACTCGAGAGTGCCGTCAGAGCAATGGAAGCAGCAGCCAACGTGGACCCACTATTCCAATCTGCACTCAGTGTGTTCATGTGGCTGGAAGAGAATGGGATTGTGACTGACATGGCCAACTTCGCACTCAGCGACCCGAACGCCCATCGGATGCGAAATTTTCTTGCAAACGCACCACAA---------------------GCAGGCAGCAAGTCGCAAAGGGCCAAGTACGGGACAGCAGGCTACGGAGTGGAGGCTCGGGGCCCCACACCAGAGGAAGCACAGAGGGAAAAAGACACACGGATCTCAAAGAAGATGGAGACCATGGGCATCTACTTTGCAACACCAGAATGGGTAGCACTCAATGGGCACCGAGGGCCAAGCCCCGGCCAG---------------------------------CTAAAGTACTGGCAGAACACACGAGAAATACCGGACCCAAACGAGGACTATCTAGACTACGTGCATGCAGAGAAGAGCCGGTTGGCATCAGAAGAACAAATCCTAAGGGCAGCTACGTCG---------ATCTACGGGGCTCCAGGACAGGCAGAGCCACCCCAAGCTTTCATAGACGAAGTTGCCAAAGTCTATGAAATCAACCATGGACGTGGCCCAAACCAAGAACAGATGAAAGATCTGCTCTTGACTGCGATGGAGATGAAGCATCGC
TRN  10010101100011001
//