EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01766 - Birna_VP2)
FAM  PF01766
PID  Birna_VP2
DES  Birnavirus VP2 protein
IPR  IPR002662
ANO  4
ALN  453
AID  0.413145
APH  ((Q9IP80_IBDV/8-452:0.39281,O55651_9VIRU/4-453:0.65082):0.13454,Q96724_9VIRU/1-442:0.92708,Q8AZM0_9VIRU/6-428:0.36266);
ATP  ((Q9IP80_IBDV/8-452,O55651_9VIRU/4-453),Q96724_9VIRU/1-442,Q8AZM0_9VIRU/6-428);
ATL  2.46791
DNO  4
DLN  1359
DID  0.473227
DPH  ((Q9IP80_IBDV/8-452:0.41955,Q8AZM0_9VIRU/6-428:0.37347):0.09655,O55651_9VIRU/4-453:0.41179,Q96724_9VIRU/1-442:0.61703);
DTP  ((Q9IP80_IBDV/8-452,Q8AZM0_9VIRU/6-428),O55651_9VIRU/4-453,Q96724_9VIRU/1-442);
DTL  1.91839
RID  0.413145
RPH  ((Q9IP80_IBDV/8-452:0.39281,O55651_9VIRU/4-453:0.65082):0.13454,Q96724_9VIRU/1-442:0.92708,Q8AZM0_9VIRU/6-428:0.36266);
RTP  ((Q9IP80_IBDV/8-452,O55651_9VIRU/4-453),Q96724_9VIRU/1-442,Q8AZM0_9VIRU/6-428);
RTL  2.46791
LNK  O55651_9VIRU/4-453:O55651:AB011440
LNK  Q8AZM0_9VIRU/6-428:Q8AZM0:AJ459382
LNK  Q96724_9VIRU/1-442:Q96724:U60650
LNK  Q9IP80_IBDV/8-452:Q9IP80:AF006701
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q8AZM0_9VIRU/6-428
ASQ  ENTQIRYLNSLLVPETGSTSIPDDTLDRHCLKTETTTENLVAALGGSGLIVLFPNSPSGLLGAHYTKTPQG-SLIFDKAITTSQDLKKAYNYARLVSRIVQVRSSTLPAGVYALNGTFNGVTYIGSLSEIKDLDYNSLLSATANINDKVGNVLVGDGVAVLSLPAGSDLPYVRLGDEVP---SSA--GVARCSPSDRPRHYNANNKQ-------VQVGTTDTKTNGFNIDATTPTEVTVDMQIAQIAAG-KTLTVTVKLMGLTGAKVASRSETVSGNG--GTFHF-----STTAVFGETEITQPVVGVQVLAKT-------NGDPI--VVDSYVGVTVHGGNMPGTLRPVTIIAYESVATGSVLTLSGISNYELIPNPELAKNIQTSYGKLNPAEMTYTKVVLSHRDELGLRSIWSIPQYRDMMSYFREVSDRSSPLKIAGAFGWGDLLSGIR
DSQ  GAAAATACACAGATCAGATACCTTAACTCCCTTCTCGTTCCAGAGACCGGGTCCACATCCATTCCAGATGACACTCTTGACAGACATTGTCTGAAAACAGAGACCACAACAGAAAATCTAGTGGCAGCTCTGGGAGGGAGCGGACTAATCGTTCTCTTTCCAAACTCACCATCAGGCCTACTGGGGGCACATTACACCAAAACCCCCCAAGGG---TCTCTAATTTTTGACAAGGCCATCACAACATCCCAAGACCTCAAGAAAGCGTACAACTATGCCAGACTTGTCAGCCGCATTGTGCAGGTGCGGAGCTCAACGCTCCCCGCGGGTGTCTACGCACTCAACGGGACCTTCAATGGGGTTACCTACATTGGAAGTCTCAGCGAGATCAAGGACCTGGACTACAATTCACTTCTCTCTGCAACGGCCAACATCAATGACAAGGTCGGCAATGTACTTGTTGGAGACGGTGTCGCAGTGCTCTCACTTCCTGCTGGAAGCGACCTGCCTTATGTTAGACTTGGCGATGAAGTTCCA---------AGCTCTGCT------GGAGTCGCGAGATGCTCTCCCTCCGACAGACCTAGGCACTACAATGCCAACAACAAACAG---------------------GTCCAGGTCGGCACGACCGACACCAAGACCAATGGGTTCAACATCGACGCAACAACACCCACAGAGGTCACGGTCGACATGCAGATAGCTCAGATAGCCGCAGGG---AAGACCCTCACGGTAACTGTCAAACTAATGGGTCTGACTGGAGCCAAGGTGGCATCCAGATCAGAGACAGTCTCCGGGAATGGC------GGGACGTTCCACTTC---------------AGCACGACAGCTGTGTTTGGAGAGACGGAGATCACACAACCAGTCGTTGGAGTACAGGTTCTCGCCAAGACG---------------------AACGGAGACCCCATT------GTGGTTGACAGCTACGTGGGGGTCACAGTACATGGAGGGAACATGCCCGGAACACTGAGACCCGTGACAATAATTGCCTACGAGTCAGTGGCAACAGGCAGCGTTCTCACACTCAGCGGCATTTCCAACTACGAGCTAATACCAAACCCAGAACTGGCAAAGAACATCCAAACCAGCTACGGCAAACTCAATCCTGCAGAGATGACCTACACGAAAGTGGTACTCTCACACAGGGATGAACTAGGGCTGAGGTCGATCTGGTCAATCCCCCAGTACAGGGACATGATGTCCTACTTCAGGGAAGTTTCAGACCGATCATCACCCCTCAAGATAGCAGGGGCCTTCGGTTGGGGCGACCTCCTTTCTGGAATCAGG
TRN  10010101100011001
NAM  Q9IP80_IBDV/8-452
ASQ  TQQIVPFIRSLLMPTTGPASIPDDTLGKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNG-NYKFDQMLLTAQNLPASYNYCRLVSRSLTVRSSTLPGGVYALNGTVNAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPISAIGLDP-KMVATCDSSDRPRVYTITAADDYQFLSQYQTGGVTITLFSANIDAITSLSIGGELVFQTSVQD-LVLGATIYLIGFDGTTVITRAVASDNGLTAGTDNL----MPFNLVIPTNEITQPITSIKLEIVT-SKSGGQAGDQMSWSASGSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAGAFGFKDIIRAIR
DSQ  ACCCAACAGATTGTTCCGTTCATACGGAGCCTTCTGATGCCAACAACCGGACCGGCGTCCATTCCGGACGACACCCTGGGGAAGCACACTCTCAGGTCAGAGACCTCGACCTACAATTTGACTGTGGGGGACACAGGGTCAGGGCTAATTGTCTTTTTCCCTGGTTTCCCTGGCTCAATTGTGGGTGCTCACTACACACTGCAGAGCAATGGG---AACTACAAGTTCGATCAGATGCTCCTGACTGCCCAGAACCTACCGGCCAGTTACAACTACTGCAGGCTAGTGAGTCGGAGTCTCACAGTGAGGTCAAGCACACTCCCTGGTGGCGTTTATGCACTAAACGGCACCGTAAACGCCGTGACCTTCCAAGGAAGCCTGAGTGAACTGACAGATGTTAGCTACAATGGGTTGATGTCTGCAACGGCCAACATCAACGACAAAATTGGGAATGTCCTAGTAGGGGAAGGGGTCACCGTCCTCAGCTTACCCACATCATATGATCTTGGGTATGTGAGGCTTGGTGACCCCATTTCTGCTATAGGGCTTGACCCA---AAAATGGTAGCCACATGTGACAGCAGTGACAGGCCCAGAGTCTACACCATAACTGCAGCCGATGATTACCAATTCTTATCACAGTACCAAACAGGTGGGGTAACAATCACACTGTTCTCAGCCAACATTGATGCTATCACAAGCCTCAGCATTGGGGGAGAGCTCGTGTTCCAAACAAGCGTCCAAGAC---CTTGTACTGGGCGCTACCATCTACCTTATAGGCTTTGATGGGACTACAGTAATCACCAGAGCTGTGGCCTCAGACAATGGGCTGACGGCCGGCACCGACAATCTT------------ATGCCATTCAATCTTGTGATTCCGACCAACGAGATAACCCAGCCAATCACATCCATCAAACTGGAGATAGTGACC---TCCAAAAGTGGCGGTCAGGCAGGGGACCAGATGTCATGGTCGGCAAGTGGGAGCCTAGCAGTGACAATCCATGGTGGCAACTATCCAGGGGCCCTCCGTCCCGTCACACTAGTAGCCTACGAAAGAGTGGCAACAGGATCCGTCGTTACGGTCGCCGGGGTGAGCAACTTCGAGTTGATCCCAAACCCTGAACTAGCAAAGAACCTGGTTACAGAATACGGCCGATTTGACCCAGGAGCCATGAACTACACAAAATTGATACTGAGTGAGAGGGACCGTCTTGGCATCAAGACCGTCTGGCCAACAAGGGAGTACACTGACTTTCGTGAGTACTTCATGGAGGTGGCCGACCTCAACTCTCCCCTGAAGATTGCAGGAGCATTTGGCTTCAAAGACATAATCCGGGCCATAAGG
TRN  10010101100011000
NAM  O55651_9VIRU/4-453
ASQ  TKATATYLRSIMLPENGPASIPDDITERHILKQETSSYNLEVSDSGSGLLVCFPGAPGSRVGAHYKWNANQTRQEFDQWLKTSQDLKKAFNYGRLISRKYDVQSSTLPAGLYALNGTLNAATFEGSLSEVESFSYNSLMSLTTNPQDKVNNQPVTKGVTVLNLPTGFDKPYVRLEDETPQGPQSMNGARMRCTAAIAPRRYEIDLPS--ARLPTVPATGTLTTMYEGNADIVNSTTVTGDISFRLDQDP-PNDTKYDFQLDFLGLDNNVPVVSITSYTLATTDNYRGVSVKFTQSIPTETITKPITRVKLSYKINQQTAIGNAATLGPLGPSSVSFSSGNGNVPGVLRPITLVAYEKMTPQSILTVAGVSNYELIPNPELLKNMVTKYGKYDPEGLNYAKMILSHREELDIRTVWRTEEYKERTRAFNEITDFSSDLPTSKAWGWRDIVRGIR
DSQ  ACAAAGGCAACCGCAACTTACTTGAGATCCATTATGCTTCCCGAGAATGGTCCAGCAAGCATTCCGGACGACATAACAGAGAGACACATACTAAAACAAGAGACCTCGTCATACAACTTAGAGGTCTCAGACTCCGGAAGTGGGCTTCTTGTCTGCTTCCCTGGAGCTCCTGGATCCAGAGTCGGTGCCCACTACAAGTGGAATGCGAACCAGACCAGGCAGGAATTCGACCAGTGGCTGAAAACATCACAGGACCTGAAGAAGGCATTCAACTACGGGAGGCTGATCTCACGGAAATACGACGTCCAGAGCTCAACCCTACCTGCTGGTCTGTATGCCCTGAATGGGACCCTGAACGCCGCGACCTTCGAAGGAAGTCTGTCTGAAGTGGAGAGCTTCTCCTACAACAGTCTGATGTCCCTCACCACGAACCCCCAGGACAAAGTGAACAACCAGCCAGTCACCAAAGGAGTGACAGTCCTAAACCTACCAACAGGGTTCGACAAGCCATACGTCCGCCTGGAGGACGAGACCCCACAAGGGCCCCAGTCAATGAACGGCGCCCGGATGAGGTGCACAGCTGCAATTGCACCACGAAGGTACGAAATCGACCTCCCATCC------GCACGCCTCCCCACAGTACCAGCGACTGGGACCCTCACAACAATGTATGAAGGGAACGCCGACATTGTGAACTCAACCACAGTGACCGGCGACATCAGCTTCAGACTGGATCAAGACCCC---CCGAACGACACGAAGTACGACTTCCAGCTCGACTTCCTCGGCTTAGACAACAACGTCCCCGTCGTGTCAATAACCAGCTATACGCTGGCCACAACCGACAACTACAGGGGGGTCTCAGTCAAATTCACACAGTCAATCCCAACAGAGACAATCACAAAACCCATCACCAGGGTCAAGCTGTCCTACAAAATCAACCAGCAGACAGCCATCGGCAATGCAGCAACGCTTGGACCCCTGGGGCCCTCATCCGTCTCATTCTCATCAGGAAACGGCAACGTACCTGGAGTGCTCAGGCCAATCACCCTGGTGGCGTACGAGAAGATGACCCCCCAGTCGATCCTGACGGTAGCTGGAGTGTCAAACTACGAGCTGATCCCAAACCCCGAACTCCTGAAGAACATGGTCACGAAATATGGCAAGTATGACCCTGAAGGTCTCAACTACGCCAAGATGATCCTGTCCCACCGAGAGGAGCTAGACATCAGAACAGTCTGGAGAACCGAGGAGTACAAGGAGAGAACAAGAGCCTTCAATGAGATCACAGACTTCTCAAGTGACCTCCCAACCTCAAAAGCCTGGGGGTGGAGAGACATTGTGAGAGGCATCCGG
TRN  10010101100011000
NAM  Q96724_9VIRU/1-442
ASQ  MNTTNEYLKTLLNPAQFISDIPDDIMIRHVNSAQTITYNLKSGASGTGLIVVYPNTPSSISGFHYIWDSATSNWVFDQYIYTAQELKDSYDYGRLISGSLSIKSSTLPAGVYALNGTFNAVWFQGTLSEVSDYSYDRILSITSNPLDKVGNVLVGDGIEVLSLPQGFNNPYVRLGDKSPSTLSSPTHITNTSQNLATGGAYMIPVTT-------VPGQGFHNKEFSINVDSVGPVDILWSGQMTMQDEWTVTANYQPLNISGTLIANSQRTLTWSNTGVSNGSHYMNMNNLNVSLFHENPPPEPVAAIKININY----GNNTNGDSSFSVDSSFTINVIGGATIGVNSPTVGVGYQGVAEGTAITISGINNYELVPNPDLQKNLPMTYGTCDPHDLTYIKYILSNREQLGLRSVMTLADYNRMKMYMHVLTNYHVDEREASSFDFWQLLKQIK
DSQ  ATGAATACGACAAACGAATACTTGAAAACTCTTTTAAACCCAGCACAATTTATCTCAGACATTCCTGATGATATAATGATCCGACACGTAAACAGCGCCCAGACCATCACCTACAACTTGAAGTCAGGGGCCTCTGGCACCGGCCTGATCGTGGTCTATCCAAACACCCCGTCGAGTATTAGCGGCTTCCATTACATATGGGATTCCGCTACCTCGAATTGGGTGTTTGATCAGTACATCTACACAGCTCAGGAGTTGAAGGACTCATATGACTATGGCAGACTGATTTCAGGCTCGCTAAGCATTAAGTCCAGCACCTTACCTGCGGGTGTTTATGCACTGAATGGCACATTCAATGCAGTCTGGTTCCAAGGGACCTTGAGTGAAGTGTCTGACTACTCTTACGATAGGATCCTGTCAATAACATCCAATCCTCTGGATAAGGTTGGAAATGTGTTGGTTGGAGACGGCATAGAGGTTCTAAGCCTGCCGCAGGGGTTCAACAACCCCTACGTTAGGCTGGGTGACAAGTCACCGTCCACTCTATCCTCTCCAACCCACATAACCAACACTTCCCAGAACTTGGCTACGGGAGGTGCATACATGATCCCAGTAACCACA---------------------GTTCCTGGGCAAGGATTCCATAACAAGGAATTCAGCATTAATGTGGACTCCGTAGGGCCAGTTGACATCTTGTGGTCTGGTCAAATGACTATGCAGGACGAATGGACTGTAACTGCAAATTATCAACCATTGAACATCTCTGGCACGCTAATTGCAAACAGTCAGCGAACCCTAACATGGTCCAACACTGGTGTATCCAATGGCAGCCACTACATGAACATGAACAACCTTAATGTCTCCCTTTTCCATGAGAATCCACCACCTGAACCCGTTGCCGCCATAAAAATAAACATCAATTAT------------GGAAACAACACCAATGGTGACAGCTCGTTCAGTGTGGACTCATCATTTACCATCAATGTCATTGGGGGCGCCACCATTGGCGTCAACTCTCCAACAGTCGGTGTTGGTTACCAAGGAGTAGCTGAGGGCACCGCCATTACAATTAGCGGTATCAACAACTATGAGCTGGTACCCAATCCGGACTTGCAAAAGAACCTGCCAATGACATATGGCACTTGTGATCCACATGATTTGACTTACATCAAGTACATACTGTCAAACCGAGAACAGTTGGGACTTAGGTCAGTGATGACCTTGGCCGACTACAATAGGATGAAGATGTACATGCATGTACTGACGAACTATCATGTCGATGAGAGGGAAGCATCGAGCTTCGATTTCTGGCAACTACTGAAACAGATAAAA
TRN  10010101100011000
//