EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01753 - zf-MYND)
FAM  PF01753
PID  zf-MYND
DES  MYND finger
IPR  IPR002893
ANO  19
ALN  44
AID  0.428633
APH  ((((((((O04261_ARATH/216-254:0.49854,(Q21826_CAEEL/146-182:0.46008,PDCD2_MOUSE/134-171:0.23585):0.07494):0.09593,O45918_CAEEL/39-79:0.57893):0.21422,O81780_ARATH/61-98:0.29424):0.09705,(Q19132_CAEEL/716-756:0.66499,YRM4_CAEEL/26-64:0.46315):0.07207):0.13640,((ZMY10_HUMAN/394-430:0.58500,(O01918_CAEEL/151-185:0.40943,ZMY11_HUMAN/523-558:0.10400):0.37330):0.18691,(DEAF1_DROME/521-557:0.27057,(DEAF1_HUMAN/504-540:0.07594,(MTG8_HUMAN/515-551:0.05591,Q24037_DROME/593-629:0.28980):0.52666):0.26447):0.24225):0.16947):0.19981,(P91821_CAEEL/49-90:0.48036,SMYD1_MOUSE/47-85:0.41878):0.53103):0.52731,YB2A_SCHPO/482-523:0.20025):0.11314,O42631_EMENI/546-587:0.06705,YMZ0_YEAST/514-555:0.28244);
ATP  ((((((((O04261_ARATH/216-254,(Q21826_CAEEL/146-182,PDCD2_MOUSE/134-171)),O45918_CAEEL/39-79),O81780_ARATH/61-98),(Q19132_CAEEL/716-756,YRM4_CAEEL/26-64)),((ZMY10_HUMAN/394-430,(O01918_CAEEL/151-185,ZMY11_HUMAN/523-558)),(DEAF1_DROME/521-557,(DEAF1_HUMAN/504-540,(MTG8_HUMAN/515-551,Q24037_DROME/593-629))))),(P91821_CAEEL/49-90,SMYD1_MOUSE/47-85)),YB2A_SCHPO/482-523),O42631_EMENI/546-587,YMZ0_YEAST/514-555);
ATL  10.4763
DNO  19
DLN  132
DID  0.472876
DPH  ((((((O81780_ARATH/61-98:0.24279,(O04261_ARATH/216-254:0.27813,O45918_CAEEL/39-79:0.47843):0.18380):0.12245,((ZMY11_HUMAN/523-558:0.15063,(O01918_CAEEL/151-185:0.28059,ZMY10_HUMAN/394-430:0.42837):0.15378):0.15598,((MTG8_HUMAN/515-551:0.20988,Q24037_DROME/593-629:0.19449):0.18056,(DEAF1_HUMAN/504-540:0.09968,DEAF1_DROME/521-557:0.38852):0.09035):0.11754):0.21295):0.11665,(Q21826_CAEEL/146-182:0.28940,PDCD2_MOUSE/134-171:0.32847):0.12148):0.07824,((YRM4_CAEEL/26-64:0.47026,(P91821_CAEEL/49-90:0.41998,SMYD1_MOUSE/47-85:0.36694):0.20984):0.12886,Q19132_CAEEL/716-756:0.49621):0.08513):0.39488,YMZ0_YEAST/514-555:0.22332):0.15751,O42631_EMENI/546-587:0.20328,YB2A_SCHPO/482-523:0.25160);
DTP  ((((((O81780_ARATH/61-98,(O04261_ARATH/216-254,O45918_CAEEL/39-79)),((ZMY11_HUMAN/523-558,(O01918_CAEEL/151-185,ZMY10_HUMAN/394-430)),((MTG8_HUMAN/515-551,Q24037_DROME/593-629),(DEAF1_HUMAN/504-540,DEAF1_DROME/521-557)))),(Q21826_CAEEL/146-182,PDCD2_MOUSE/134-171)),((YRM4_CAEEL/26-64,(P91821_CAEEL/49-90,SMYD1_MOUSE/47-85)),Q19132_CAEEL/716-756)),YMZ0_YEAST/514-555),O42631_EMENI/546-587,YB2A_SCHPO/482-523);
DTL  8.31097
RID  0.428633
RPH  ((((((((O04261_ARATH/216-254:0.49854,(Q21826_CAEEL/146-182:0.46008,PDCD2_MOUSE/134-171:0.23585):0.07494):0.09593,O45918_CAEEL/39-79:0.57893):0.21422,O81780_ARATH/61-98:0.29424):0.09705,(Q19132_CAEEL/716-756:0.66499,YRM4_CAEEL/26-64:0.46315):0.07207):0.13640,((ZMY10_HUMAN/394-430:0.58500,(O01918_CAEEL/151-185:0.40943,ZMY11_HUMAN/523-558:0.10400):0.37330):0.18691,(DEAF1_DROME/521-557:0.27057,(DEAF1_HUMAN/504-540:0.07594,(MTG8_HUMAN/515-551:0.05591,Q24037_DROME/593-629:0.28980):0.52666):0.26447):0.24225):0.16947):0.19981,(P91821_CAEEL/49-90:0.48036,SMYD1_MOUSE/47-85:0.41878):0.53103):0.52731,YB2A_SCHPO/482-523:0.20025):0.11314,O42631_EMENI/546-587:0.06705,YMZ0_YEAST/514-555:0.28244);
RTP  ((((((((O04261_ARATH/216-254,(Q21826_CAEEL/146-182,PDCD2_MOUSE/134-171)),O45918_CAEEL/39-79),O81780_ARATH/61-98),(Q19132_CAEEL/716-756,YRM4_CAEEL/26-64)),((ZMY10_HUMAN/394-430,(O01918_CAEEL/151-185,ZMY11_HUMAN/523-558)),(DEAF1_DROME/521-557,(DEAF1_HUMAN/504-540,(MTG8_HUMAN/515-551,Q24037_DROME/593-629))))),(P91821_CAEEL/49-90,SMYD1_MOUSE/47-85)),YB2A_SCHPO/482-523),O42631_EMENI/546-587,YMZ0_YEAST/514-555);
RTL  10.4763
LNK  DEAF1_DROME/521-557:Q24180:AE003515
LNK  DEAF1_HUMAN/504-540:O75398:AF049459
LNK  MTG8_HUMAN/515-551:Q06455:D14821
LNK  O01918_CAEEL/151-185:O01918:AF003389
LNK  O04261_ARATH/216-254:O04261:AF001308
LNK  O42631_EMENI/546-587:O42631:AJ000996
LNK  O45918_CAEEL/39-79:O45918:Z71180
LNK  O81780_ARATH/61-98:O81780:AL031004
LNK  P91821_CAEEL/49-90:P91821:Z81125
LNK  PDCD2_MOUSE/134-171:P46718:U10903
LNK  Q19132_CAEEL/716-756:Q19132:Z66511
LNK  Q21826_CAEEL/146-182:Q21826:Z32683
LNK  Q24037_DROME/593-629:Q24037:U21717
LNK  SMYD1_MOUSE/47-85:P97443:U76373
LNK  YB2A_SCHPO/482-523:P87311:Z97204
LNK  YMZ0_YEAST/514-555:Q03162:Z49807
LNK  YRM4_CAEEL/26-64:Q09415:Z46794
LNK  ZMY10_HUMAN/394-430:O75800:U70824
LNK  ZMY11_HUMAN/523-558:Q15326:X86098
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxx
NAM  YB2A_SCHPO/482-523
ASQ  NLLCNKWEEHSRQFAKCRRCRRTKYCSKECQHQAWP-.GHSRWC
DSQ  AATTTGTTATGTAACAAATGGGAAGAGCACAGTCGTCAATTTGCTAAATGCAGAAGATGCCGACGTACAAAATATTGCAGTAAAGAATGCCAGCATCAAGCATGGCCG---...GGACATAGTCGATGGTGT
TRN  10110101110011010
NAM  YMZ0_YEAST/514-555
ASQ  NFSCGKWEDFPRQFAKCRRCKRTKYCSRKCQLKAWG-.YHRYWC
DSQ  AATTTTTCGTGCGGAAAATGGGAAGATTTTCCAAGACAATTTGCAAAATGTCGTCGATGCAAAAGAACGAAATATTGCTCACGAAAGTGTCAATTAAAAGCATGGGGA---...TATCATAGGTATTGGTGT
TRN  10110101110011000
NAM  O42631_EMENI/546-587
ASQ  NYKCGKWEEFTRQFAKCRRCRRTKYCSKDCQKAAWL-.YHRHWC
DSQ  AATTACAAATGCGGTAAGTGGGAAGAGTTCACACGTCAATTCGCCAAATGCCGCCGCTGCCGTCGCACCAAGTACTGCAGCAAGGATTGCCAGAAAGCAGCGTGGCTC---...TACCACCGTCACTGGTGC
TRN  11011101111011011
NAM  SMYD1_MOUSE/47-85
ASQ  CHTCFKRQ---EKLHRCGQCKFAHYCDRTCQKDAWL-.NHKNEC
DSQ  TGCCACACCTGCTTCAAGAGGCAG---------GAGAAGCTCCATCGCTGCGGGCAGTGCAAGTTCGCCCATTACTGCGACCGCACGTGCCAGAAGGATGCTTGGCTG---...AATCACAAGAACGAGTGC
TRN  10010101100011011
NAM  P91821_CAEEL/49-90
ASQ  CANCLRGPAPGEKLLRCGGCNFSMYCSKECQATAWL-.VHKPEC
DSQ  TGTGCAAACTGTCTTCGTGGTCCTGCTCCAGGAGAGAAGCTTCTTCGTTGTGGTGGATGTAATTTCTCAATGTATTGTAGTAAAGAGTGTCAGGCAACTGCCTGGTTA---...GTTCATAAACCAGAATGC
TRN  11011101111011000
NAM  O45918_CAEEL/39-79
ASQ  CTYCGSSCTSS-QLQTCLFCGTVAYCSKEHQQLDWL-.THKMIC
DSQ  TGTACATATTGTGGAAGCTCGTGCACATCTTCC---CAATTGCAAACATGTTTATTCTGTGGAACAGTGGCTTATTGTTCCAAGGAGCACCAGCAACTCGATTGGCTA---...ACACATAAAATGATATGC
TRN  10010101110011010
NAM  PDCD2_MOUSE/134-171
ASQ  CRVCGCLAP-----MTCSRCKQAHYCSKEHQTLDWRL.GHKQAC
DSQ  TGTCGGGTTTGTGGTTGCTTGGCCCCT---------------ATGACATGCTCTAGGTGCAAACAGGCACATTACTGCAGCAAGGAGCATCAGACATTAGACTGGCGGCTG...GGACACAAGCAGGCTTGT
TRN  10010101100011010
NAM  O04261_ARATH/216-254
ASQ  CTWCGTWKGD----KLCSGCKNARYCSPKHQALHWRL.GHKTEC
DSQ  TGCACTTGGTGTGGAACATGGAAAGGAGAT------------AAACTATGTAGCGGCTGCAAAAATGCTCGATACTGTTCACCGAAACACCAGGCCCTGCATTGGCGCTTG...GGTCATAAAACCGAATGC
TRN  11011101101011001
NAM  Q21826_CAEEL/146-182
ASQ  CRICGCSAA-----KKCAKCQVARYCSQAHQVIDWP-.AHKLEC
DSQ  TGTCGAATCTGTGGATGTTCCGCTGCG---------------AAAAAATGTGCCAAGTGCCAAGTGGCGAGATATTGCTCTCAAGCTCATCAAGTCATCGACTGGCCT---...GCTCACAAGCTCGAATGT
TRN  10010101110011011
NAM  YRM4_CAEEL/26-64
ASQ  CNQCLTSM---AELKKCSACRRLAYCSQECQRADWK-.LHKVEC
DSQ  TGTAATCAATGCCTTACGAGTATG---------GCAGAACTCAAAAAGTGCAGCGCCTGCCGACGGCTTGCTTATTGCTCACAAGAATGTCAAAGAGCTGACTGGAAG---...CTGCATAAAGTGGAGTGT
TRN  10010101100011001
NAM  Q19132_CAEEL/716-756
ASQ  CHECGNSKLKLK---ACEECYDAVYCSKECQVANWSTgGHREEC
DSQ  TGCCATGAGTGTGGAAATTCAAAGTTGAAGCTGAAG---------GCTTGTGAAGAGTGTTATGATGCTGTCTATTGCTCCAAAGAGTGTCAAGTTGCAAACTGGTCAACTggaGGGCACCGTGAAGAGTGC
TRN  11011101101011001
NAM  O81780_ARATH/61-98
ASQ  CSVCGNFSTK-----KCSRCKSVRYCSAECQRSDWSS.GHQRNC
DSQ  TGCTCTGTCTGTGGGAATTTTTCCACCAAG---------------AAATGCTCCCGCTGCAAATCCGTTCGATACTGCTCAGCAGAGTGCCAAAGGTCAGATTGGAGTTCG...GGTCATCAAAGAAACTGC
TRN  10110101110011001
NAM  DEAF1_DROME/521-557
ASQ  CANCNREALA-----ECSLCRKTPYCSEFCQRKDWN-.AHQVEC
DSQ  TGCGCCAACTGTAACCGCGAAGCATTGGCC---------------GAGTGCTCACTGTGCCGAAAGACGCCGTACTGCTCGGAGTTCTGCCAGCGGAAGGATTGGAAT---...GCTCACCAGGTGGAGTGC
TRN  11011111101111101
NAM  DEAF1_HUMAN/504-540
ASQ  CVNCGREAMS-----ECTGCHKVNYCSTFCQRKDWK-.DHQHIC
DSQ  TGCGTTAACTGCGGCCGGGAGGCTATGAGC---------------GAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCCAACGCAAGGACTGGAAG---...GATCACCAGCACATATGC
TRN  10010111110111011
NAM  Q24037_DROME/593-629
ASQ  CWNCGRKATE-----TCSGCNMARYCSASCQYRDWD-.SHHQVC
DSQ  TGCTGGAACTGCGGGCGCAAGGCAACGGAG---------------ACCTGTTCCGGCTGCAACATGGCGCGATATTGCAGCGCCTCGTGTCAGTACAGGGATTGGGAT---...AGTCACCATCAGGTTTGT
TRN  10110101110011011
NAM  MTG8_HUMAN/515-551
ASQ  CWNCGRKASE-----TCSGCNTARYCGSFCQHKDWE-.KHHHIC
DSQ  TGCTGGAATTGTGGCCGTAAAGCGAGTGAA---------------ACCTGCAGTGGCTGTAACACAGCCCGATACTGTGGCTCATTTTGCCAGCACAAAGACTGGGAG---...AAGCACCATCACATCTGT
TRN  11111101111011001
NAM  ZMY11_HUMAN/523-558
ASQ  CYNCEEEAMY-----HC--CWNTSYCSIKCQQEHWHA.EHKRTC
DSQ  TGCTACAACTGTGAGGAGGAGGCCATGTAC---------------CACTGC------TGCTGGAACACATCCTACTGCTCCATCAAGTGCCAGCAGGAGCACTGGCACGCG...GAGCACAAGCGCACCTGC
TRN  11111111111111111
NAM  O01918_CAEEL/151-185
ASQ  CWSCDNEAIY-----HC--CWNTAYCSVECQQGHWQ-.THRKFC
DSQ  TGCTGGTCGTGTGATAATGAGGCTATATAC---------------CATTGC------TGCTGGAATACCGCATATTGCAGTGTTGAATGCCAACAGGGACATTGGCAG---...ACTCATCGAAAGTTTTGC
TRN  10010111110111011
NAM  ZMY10_HUMAN/394-430
ASQ  CAYCSAEASK-----RCSRCQNEWYCCRECQVKHWE-.KHGKTC
DSQ  TGTGCTTACTGCAGTGCAGAGGCTTCTAAG---------------CGCTGCTCACGATGCCAGAATGAGTGGTATTGCTGCAGGGAGTGCCAAGTCAAGCACTGGGAA---...AAGCATGGAAAGACTTGT
TRN  10110101110011001
//