EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01745 - IPT)
FAM  PF01745
PID  IPT
DES  Isopentenyl transferase
IPR  IPR002648
ANO  7
ALN  240
AID  0.386326
APH  (((IPT_RHOFA/20-252:1.39665,((IPT2_RALSO/3-236:0.47898,IPT_PANAY/3-236:0.67928):0.14552,IPT_PSESS/1-231:0.42707):0.09780):0.14715,IPTZ_AGRT7/1-232:0.33318):0.18231,IPT_AGRTU/1-235:0.33697,IPT1_AGRVI/1-233:0.43662);
ATP  (((IPT_RHOFA/20-252,((IPT2_RALSO/3-236,IPT_PANAY/3-236),IPT_PSESS/1-231)),IPTZ_AGRT7/1-232),IPT_AGRTU/1-235,IPT1_AGRVI/1-233);
ATL  4.626
DNO  7
DLN  720
DID  0.466003
DPH  ((IPTZ_AGRT7/1-232:0.30205,(IPT_AGRTU/1-235:0.25033,IPT1_AGRVI/1-233:0.37542):0.15110):0.10112,(IPT_PANAY/3-236:0.54467,IPT_PSESS/1-231:0.31109):0.11071,(IPT2_RALSO/3-236:0.36622,IPT_RHOFA/20-252:0.81755):0.17467);
DTP  ((IPTZ_AGRT7/1-232,(IPT_AGRTU/1-235,IPT1_AGRVI/1-233)),(IPT_PANAY/3-236,IPT_PSESS/1-231),(IPT2_RALSO/3-236,IPT_RHOFA/20-252));
DTL  3.50493
RID  0.386326
RPH  (((IPT_RHOFA/20-252:1.39665,((IPT2_RALSO/3-236:0.47898,IPT_PANAY/3-236:0.67928):0.14552,IPT_PSESS/1-231:0.42707):0.09780):0.14715,IPTZ_AGRT7/1-232:0.33318):0.18231,IPT_AGRTU/1-235:0.33697,IPT1_AGRVI/1-233:0.43662);
RTP  (((IPT_RHOFA/20-252,((IPT2_RALSO/3-236,IPT_PANAY/3-236),IPT_PSESS/1-231)),IPTZ_AGRT7/1-232),IPT_AGRTU/1-235,IPT1_AGRVI/1-233);
RTL  4.626
LNK  IPT1_AGRVI/1-233:Q04590:M91610
LNK  IPT2_RALSO/3-236:P14333:X16381
LNK  IPT_AGRTU/1-235:P15653:X14410
LNK  IPT_PANAY/3-236:Q47851:Z46375
LNK  IPT_PSESS/1-231:P06619:X03679
LNK  IPT_RHOFA/20-252:P46376:Z29635
LNK  IPTZ_AGRT7/1-232:P06524:X02423
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IPT_RHOFA/20-252
ASQ  PGVYAIVGATGIGKSAEASKLALSHSAPIVVADRIQCYSDLLVTSGRAFDAKVEGLNRVWLD-NRTIHQGNFDPDEAFDRLIKVLTSYVDRGEAVVMEGGSISLILRFAQTISN-LPFPAVVNVMPIPDRQHYFAQQCARARQMLRGDSTGRNLLTELAEAWVLGDQHNFIASVAGLDCVLDWCATHSVTPEELANRDLTTEVLDELAASMGGRYVEHGVLQQEIFLRT-----FGAPGV
DSQ  CCCGGCGTATACGCAATCGTCGGTGCCACCGGAATTGGAAAGAGCGCCGAAGCGAGCAAGTTGGCATTGAGTCACTCGGCTCCGATTGTTGTTGCCGACCGTATCCAGTGTTACTCCGATCTCCTGGTCACCAGTGGTCGAGCGTTCGACGCGAAAGTGGAAGGGCTCAACCGCGTTTGGCTCGAC---AACCGGACCATACATCAGGGCAACTTCGATCCGGACGAGGCCTTTGACCGGCTGATAAAAGTACTGACCTCGTACGTTGATCGCGGCGAAGCGGTGGTAATGGAGGGCGGTTCGATATCGCTCATTCTTCGATTCGCGCAAACGATATCCAAC---CTACCGTTCCCAGCTGTCGTGAATGTTATGCCTATTCCTGATAGGCAACACTACTTTGCCCAGCAGTGCGCAAGGGCACGACAAATGTTACGGGGAGATTCAACGGGCAGGAATTTACTCACCGAACTGGCGGAAGCGTGGGTTCTAGGCGATCAGCACAACTTCATAGCCTCGGTTGCGGGTCTGGACTGTGTACTCGACTGGTGCGCCACGCATTCCGTAACACCAGAGGAGTTGGCCAACCGAGACCTCACCACGGAGGTGCTCGACGAACTGGCGGCATCAATGGGTGGCCGGTATGTCGAGCACGGCGTCCTTCAGCAGGAAATATTTTTAAGAACC---------------TTCGGTGCCCCAGGTGTG
TRN  10010101100011000
NAM  IPT_PSESS/1-231
ASQ  MKIYLIWGATCTGKTEHSIKLSKSTGWPVIVLDRVQCCFDIATGSGRPHPEELQSTRRIYLD-NRRISEGVISAEEANDRLKLEVNKHID-SGGVILEGGSISLLKLISKDPYWCDRFIWSQHRMRLQDTDVFMDKAKARVRRMLVGSTETTGLLDELVAAQSDLNAKLAIQDIDGYRYIMNYAQARRLSITQLLNVMTG-DMKEELINGIALEYYEHAKWQERDFPAE------WLAER
DSQ  ATGAAAATATATTTAATATGGGGTGCTACTTGTACCGGAAAGACCGAGCATTCTATTAAGTTATCAAAGAGTACTGGTTGGCCAGTCATAGTCTTGGATAGGGTTCAGTGCTGTTTCGATATTGCCACAGGTAGTGGGCGGCCGCATCCTGAAGAGCTACAATCAACGCGGCGTATATACTTAGAT---AATCGTCGCATTTCTGAAGGGGTTATAAGTGCAGAAGAAGCTAATGACAGGCTCAAGTTGGAAGTAAATAAACATATAGAT---AGTGGTGGGGTTATTCTTGAGGGGGGGTCGATTTCGTTGTTGAAGCTTATTTCTAAAGACCCATACTGGTGCGATAGATTTATATGGAGCCAGCATAGAATGAGATTGCAAGATACCGATGTATTCATGGATAAAGCCAAAGCACGCGTTAGGCGTATGCTTGTAGGCTCTACAGAAACCACGGGGTTGTTAGACGAGTTGGTTGCGGCTCAGTCAGACCTTAATGCTAAACTCGCTATACAAGATATTGACGGATATCGATATATTATGAACTATGCTCAGGCGCGTCGCCTCAGTATCACTCAACTTCTGAATGTGATGACTGGT---GATATGAAAGAGGAGCTCATTAATGGAATAGCATTAGAATACTATGAGCATGCTAAATGGCAAGAGCGCGATTTCCCTGCGGAG------------------TGGCTCGCTGAACGT
TRN  10010101100011000
NAM  IPT1_AGRVI/1-233
ASQ  MEAHLIFGPTSTGKTSVAIALAKRTGFPVIVLDRIQCYSQLSVGGGRPSAAEFQGTRRIYLI-EGSLDEGVISAERAHECLVAAVEAHKP-EGGVILEGGSISLFKRMAQSSYWNCGFTWHVTRLHLGGEEIFLAAAKKRINQMMQPDEQGNSFLGELVSVWKTTALRATLEGICGYRYAIEFAGKQGLEMDALTSLNR--RQLEQLVHGMAHEYLCYARQQEQELPLP---SLAGGEGP
DSQ  ATGGAAGCACACTTGATCTTCGGGCCGACATCTACGGGAAAAACTTCAGTTGCAATAGCTCTTGCTAAAAGAACTGGTTTTCCTGTGATAGTACTGGACCGAATCCAATGCTACTCCCAGCTTTCTGTTGGAGGTGGGCGACCTTCTGCTGCAGAATTTCAAGGAACCAGGCGTATTTACCTGATT---GAAGGATCGCTTGATGAAGGTGTAATCAGCGCTGAACGAGCTCATGAATGTCTCGTCGCAGCAGTCGAAGCTCACAAGCCC---GAGGGTGGGGTGATACTTGAGGGGGGCTCAATCTCACTGTTCAAACGTATGGCTCAAAGCAGCTATTGGAATTGTGGCTTTACATGGCATGTCACCCGACTTCACCTCGGCGGTGAAGAGATTTTTCTGGCAGCGGCGAAGAAGAGGATCAATCAGATGATGCAACCGGATGAGCAGGGAAATTCATTTTTGGGAGAACTGGTCTCTGTCTGGAAGACAACTGCGCTGAGAGCCACACTTGAGGGAATATGTGGCTATCGTTATGCTATAGAATTTGCTGGGAAGCAGGGTCTGGAGATGGATGCACTTACAAGCCTGAACCGT------CGTCAACTTGAGCAGTTGGTGCACGGTATGGCGCATGAATATCTCTGCTACGCCCGTCAACAGGAACAAGAACTTCCCTTGCCC---------TCGCTTGCTGGTGGGGAGGGACCT
TRN  10010101100011001
NAM  IPT_AGRTU/1-235
ASQ  MDLRLIFGPTCTGKTSTAIALAQQTGLPVLSLDRVQCCPQLSTGSGRPTVEELKGTTRLYLD-DRPLVKGIITAKQAHERLIAEVHNHEA-KGGLILEGGSISLLRCMAQSRYWNADFRWHIIRNELADEESFMSVAKTRVKQMLRP-SAGLSIIQELVQLWREPRLRPILEGIDGYRYALLFATQNQITPDMLLQLDA--DMENKLIHGIAQEFLIHARRQEQKFPLVGATAVEAFEGP
DSQ  ATGGATCTACGTCTAATTTTCGGTCCAACTTGCACAGGAAAGACATCGACTGCGATAGCTCTTGCCCAGCAGACTGGCCTCCCAGTCCTCTCGCTCGATCGCGTCCAATGCTGTCCTCAACTATCAACCGGAAGCGGGCGACCAACAGTGGAAGAACTGAAAGGAACGACTCGTCTGTACCTTGAT---GATCGCCCTTTGGTAAAGGGTATCATTACAGCCAAGCAAGCTCATGAACGGCTCATTGCGGAGGTGCACAATCACGAGGCC---AAAGGCGGGCTTATTCTTGAGGGAGGATCTATCTCGTTGCTCAGGTGCATGGCGCAAAGTCGTTATTGGAACGCGGATTTTCGTTGGCATATTATTCGCAACGAGTTAGCAGACGAGGAGAGCTTCATGAGCGTGGCCAAGACCAGAGTTAAGCAGATGTTACGCCCC---TCTGCAGGTCTTTCTATTATCCAAGAGTTGGTTCAACTTTGGAGGGAGCCTCGGCTGAGGCCCATACTGGAAGGGATCGATGGATATCGATATGCCCTGCTATTTGCTACCCAGAACCAGATCACGCCCGATATGCTATTGCAGCTCGACGCA------GATATGGAGAATAAATTGATTCACGGTATCGCTCAGGAGTTTCTAATCCATGCGCGTCGACAGGAACAGAAATTCCCTTTGGTGGGCGCGACAGCTGTCGAAGCGTTTGAAGGACCA
TRN  10010101100011000
NAM  IPTZ_AGRT7/1-232
ASQ  MILHLIYGPTCSGKTDMAIQIAQETGWPVVALDRVQCCPQIATGSGRPLESELQSTRRIYLD-SRPLTEGILDAESAHRRLIFEVDWRKS-EDGLILEGGSISLLNCMAKSPFWRSGFQWHVKRLRLGDSDAFLTRAKQRVAEMFAIREDRPSLLEELAELWNYPAARPILEDIDGYRCAIRFARKHDLAISQLPNIDA--GRHVELIEAIANEYLEHALSQERDFPQWP----EDGAGQ
DSQ  ATGATACTCCATCTCATCTACGGACCGACTTGCAGCGGCAAAACGGACATGGCGATCCAAATCGCACAAGAAACCGGGTGGCCGGTGGTTGCCCTTGATCGTGTGCAATGCTGTCCTCAAATCGCGACAGGTAGCGGAAGACCTTTGGAATCGGAATTGCAATCAACGCGGAGAATATATTTGGAT---TCCCGCCCCCTCACCGAGGGCATCCTTGACGCTGAGAGTGCCCATCGTCGACTCATATTCGAAGTGGATTGGCGGAAGTCC---GAAGACGGTCTTATTCTCGAGGGCGGGTCGATTTCGCTTCTCAATTGCATGGCTAAAAGTCCGTTTTGGAGATCGGGTTTTCAATGGCATGTCAAGCGGCTACGTCTTGGGGATTCGGACGCCTTTCTCACCCGAGCCAAGCAACGCGTTGCGGAAATGTTTGCCATCCGGGAAGATCGCCCCTCGTTGTTGGAGGAGTTGGCGGAACTCTGGAACTACCCTGCCGCTCGACCGATTTTGGAAGATATCGACGGATATCGCTGCGCAATTCGTTTTGCGCGCAAACACGATCTCGCAATCAGCCAGTTGCCAAATATTGATGCA------GGGCGGCACGTAGAGCTCATAGAGGCCATAGCTAATGAATATCTTGAACATGCGCTCTCGCAGGAGCGCGATTTTCCTCAGTGGCCA------------GAAGATGGCGCAGGACAG
TRN  10010101110011001
NAM  IPT_PANAY/3-236
ASQ  GNVYLLWGATTTGKTAFSVSVAKERGWSVIALDRFQGYHEISTGSGAPTNNELEKTERIYITPQRGLADGIITAKDYNYWLKSRVLSLPEGKSDFIIEGGSVSLLKEMVSDEFW-ADFLWEIKIFRAPSKDVFIKRAKRRITDMLHPEDGRPSIMDEVSSFFMNHKTIHPLEDIDGYRTIIDYCRCKKIGFDKLKIMTT--DQEKIIISGIAEEYYAHALWQEQETPCFP---HSWSRRW
DSQ  GGAAACGTTTATTTATTATGGGGTGCAACAACTACAGGGAAAACAGCGTTTTCTGTTTCTGTTGCAAAAGAACGCGGCTGGTCAGTGATAGCTCTGGACAGGTTTCAGGGTTATCACGAAATAAGCACCGGAAGCGGAGCCCCCACCAATAATGAACTGGAAAAAACAGAAAGAATATATATCACTCCACAGAGAGGTCTGGCTGATGGGATTATCACCGCAAAGGATTATAATTATTGGCTAAAAAGCAGAGTGCTATCCTTGCCAGAAGGAAAGTCAGATTTCATTATCGAAGGGGGTTCGGTTTCATTACTTAAAGAGATGGTGAGTGATGAATTCTGG---GCGGATTTTTTATGGGAAATAAAAATATTCAGAGCACCATCAAAAGACGTTTTTATCAAAAGGGCAAAAAGAAGGATAACTGACATGCTCCATCCGGAAGATGGGAGGCCTTCGATAATGGATGAGGTGAGTTCTTTTTTTATGAATCACAAAACCATTCATCCGCTGGAAGACATTGATGGATACCGCACCATTATAGATTATTGCAGATGCAAAAAAATTGGATTTGATAAATTAAAAATTATGACAACC------GACCAGGAGAAGATAATAATCAGTGGGATAGCTGAAGAATATTACGCACATGCTTTATGGCAGGAACAAGAGACCCCCTGTTTTCCA---------CATTCCTGGTCCAGGAGGTGG
TRN  10010101100011000
NAM  IPT2_RALSO/3-236
ASQ  IRLYLIWGATTTGKTAQSVALARATGAPVISLDRVQCCHELAVGSGRPLPSELLGTRREYLC-DRSVSSGVIPAADANQLLFDKVVRYSAHERALILEGGSVSLINAMIRDARWSALGEWALRRIVLPGRAVFIAQAIKRVRDMLEPPPGHASILDELEGLWAHPGNHAVLEDVDGYRQIIRYARASQVPIDRITSIDR--STMATLVERIAQEYWEHALWQEQEFLGIP---ATWRRAD
DSQ  ATTCGCCTGTATCTGATCTGGGGCGCCACCACCACGGGCAAGACCGCGCAGTCCGTCGCCCTGGCCCGCGCCACCGGCGCGCCCGTCATTTCACTCGATCGGGTGCAATGCTGCCACGAGCTGGCGGTGGGGAGCGGCCGCCCGTTGCCGTCCGAGCTGCTCGGGACGCGGCGCGAATACCTGTGC---GACCGCAGCGTGTCGAGCGGCGTGATCCCGGCGGCGGACGCGAATCAGTTGCTGTTCGACAAGGTGGTCCGCTATTCGGCCCATGAGCGGGCGCTGATCCTGGAGGGCGGCTCGGTCTCGCTGATCAACGCGATGATCCGCGATGCGCGCTGGTCGGCGCTGGGCGAGTGGGCATTGCGCAGGATCGTGCTGCCGGGACGGGCGGTCTTCATAGCGCAGGCCATCAAGCGCGTGCGGGACATGCTCGAGCCGCCGCCGGGGCACGCGAGCATCCTGGACGAACTGGAGGGTCTGTGGGCGCATCCCGGGAATCACGCCGTCCTGGAAGATGTCGACGGATACCGGCAGATCATCCGCTATGCGCGAGCATCGCAGGTGCCCATCGATCGGATCACCTCGATCGACCGG------AGCACGATGGCGACCCTGGTGGAGCGGATCGCGCAGGAGTATTGGGAGCATGCGCTCTGGCAGGAGCAGGAGTTTCTCGGCATTCCG---------GCCACCTGGCGCCGCGCGGAT
TRN  10010101100011001
//