EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01695 - IstB)
FAM  PF01695
PID  IstB
DES  IstB-like ATP binding protein
IPR  IPR002611
ANO  17
ALN  184
AID  0.336924
APH  (((((ISTB_PSEAE/51-228:0.38471,((ISTB_BACST/52-229:0.32622,ISTB_BACTB/55-232:0.45664):0.10661,(O06369_MYCTU/63-223:0.63121,O69925_STRCO/56-233:0.34609):0.11750):0.02238):0.10004,P74994_ECOLI/56-235:0.39273):0.07365,(Y4IQ_RHISN/60-238:0.55835,(Y4BM_RHISN/58-236:0.34684,((P96960_PSEAC/242-419:0.53282,(ISTB_BURCE/51-229:0.22967,ISTB_PSEFL/53-231:0.45929):0.14560):0.06784,(Y4PL_RHISN/53-230:0.18356,Y4UH_RHISN/53-230:0.34980):0.14171):0.09461):0.70616):0.21258):0.12010,(O07445_RHOER/66-241:0.93919,ISTB2_BACFR/61-238:0.75301):0.19711):0.45097,P95447_PSEAC/1-179:0.20388,Q57115_PSEAE/54-231:0.21523);
ATP  (((((ISTB_PSEAE/51-228,((ISTB_BACST/52-229,ISTB_BACTB/55-232),(O06369_MYCTU/63-223,O69925_STRCO/56-233))),P74994_ECOLI/56-235),(Y4IQ_RHISN/60-238,(Y4BM_RHISN/58-236,((P96960_PSEAC/242-419,(ISTB_BURCE/51-229,ISTB_PSEFL/53-231)),(Y4PL_RHISN/53-230,Y4UH_RHISN/53-230))))),(O07445_RHOER/66-241,ISTB2_BACFR/61-238)),P95447_PSEAC/1-179,Q57115_PSEAE/54-231);
ATL  9.91491
DNO  16
DLN  552
DID  0.449266
DPH  (((((((((P95447_PSEAC/1-179:0.23626,Q57115_PSEAE/54-231:0.25675):0.31721,(((ISTB_BACST/52-229:0.28579,ISTB_BACTB/55-232:0.44444):0.10571,P74994_ECOLI/56-235:0.39142):0.07469,ISTB_PSEAE/51-228:0.35336):0.08171):0.10052,O69925_STRCO/56-233:0.24868):0.06800,Y4IQ_RHISN/60-238:0.46744):0.08955,O06369_MYCTU/63-223:0.34545):0.09615,(O07445_RHOER/66-241:0.49519,ISTB2_BACFR/61-238:0.51036):0.14329):0.28093,Y4BM_RHISN/58-236:0.31030):0.06620,(P96960_PSEAC/242-419:0.34633,ISTB_PSEFL/53-231:0.43118):0.08172):0.08039,Y4PL_RHISN/53-230:0.20535,Y4UH_RHISN/53-230:0.28917);
DTP  (((((((((P95447_PSEAC/1-179,Q57115_PSEAE/54-231),(((ISTB_BACST/52-229,ISTB_BACTB/55-232),P74994_ECOLI/56-235),ISTB_PSEAE/51-228)),O69925_STRCO/56-233),Y4IQ_RHISN/60-238),O06369_MYCTU/63-223),(O07445_RHOER/66-241,ISTB2_BACFR/61-238)),Y4BM_RHISN/58-236),(P96960_PSEAC/242-419,ISTB_PSEFL/53-231)),Y4PL_RHISN/53-230,Y4UH_RHISN/53-230);
DTL  7.22033
RID  0.33319
RPH  (((((((O06369_MYCTU/63-223:0.63396,O69925_STRCO/56-233:0.34586):0.11877,(ISTB_BACST/52-229:0.32744,ISTB_BACTB/55-232:0.45825):0.10685):0.02388,ISTB_PSEAE/51-228:0.38315):0.10196,P74994_ECOLI/56-235:0.39191):0.07632,(Y4IQ_RHISN/60-238:0.57313,(((P96960_PSEAC/242-419:0.51919,ISTB_PSEFL/53-231:0.61678):0.05054,(Y4PL_RHISN/53-230:0.17018,Y4UH_RHISN/53-230:0.36869):0.13778):0.10472,Y4BM_RHISN/58-236:0.34988):0.70012):0.20220):0.11523,(O07445_RHOER/66-241:0.94232,ISTB2_BACFR/61-238:0.75429):0.19615):0.45267,P95447_PSEAC/1-179:0.20303,Q57115_PSEAE/54-231:0.21685);
RTP  (((((((O06369_MYCTU/63-223,O69925_STRCO/56-233),(ISTB_BACST/52-229,ISTB_BACTB/55-232)),ISTB_PSEAE/51-228),P74994_ECOLI/56-235),(Y4IQ_RHISN/60-238,(((P96960_PSEAC/242-419,ISTB_PSEFL/53-231),(Y4PL_RHISN/53-230,Y4UH_RHISN/53-230)),Y4BM_RHISN/58-236))),(O07445_RHOER/66-241,ISTB2_BACFR/61-238)),P95447_PSEAC/1-179,Q57115_PSEAE/54-231);
RTL  9.66197
LNK  ISTB2_BACFR/61-238:Q45120:U05888
LNK  ISTB_BACST/52-229:Q45619:X67861
LNK  ISTB_BACTB/55-232:Q99338:M38370
LNK  ISTB_BURCE/51-229:P55923:
LNK  ISTB_PSEAE/51-228:P15026:X14793
LNK  ISTB_PSEFL/53-231:Q51762:X79443
LNK  O06369_MYCTU/63-223:O06369:BX842583
LNK  O07445_RHOER/66-241:O07445:AF002247
LNK  O69925_STRCO/56-233:O69925:AL939127
LNK  P74994_ECOLI/56-235:P74994:AJ488511
LNK  P95447_PSEAC/1-179:P95447:U67315
LNK  P96960_PSEAC/242-419:P96960:U84154
LNK  Q57115_PSEAE/54-231:Q57115:U49101
LNK  Y4BM_RHISN/58-236:P55380:AE000066
LNK  Y4IQ_RHISN/60-238:P55500:AE000079
LNK  Y4PL_RHISN/53-230:P55617:AE000090
LNK  Y4UH_RHISN/53-230:Q53200:Z68203
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxx.xxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxx
NAM  Y4UH_RHISN/53-230
ASQ  NKRLALRLRNAKLH-HPAVPEDIIRRAPREYDRTILDLL-IAGDWIRKHENCAIVGPTGIGKSWLACALGHKACR.DNHSVLYVRMPALLQSLEQARGIGSLATRLKSLGAV.ELLILDDYGLQPIDGNAPHYLLEILEGRYGRRSTLVTSQFPVARWHEKIS.DPTYADAILDRLVHNA.HRL
DSQ  AACAAGCGTCTTGCGCTCCGACTTCGTAACGCGAAACTGCAC---CATCCCGCTGTTCCCGAAGATATCATTCGCCGTGCACCGCGCGAATACGATCGCACCATCCTCGACCTGCTG---ATTGCCGGCGACTGGATCAGAAAACACGAGAACTGTGCCATTGTCGGCCCGACCGGCATCGGGAAAAGCTGGTTGGCCTGTGCCTTGGGACACAAGGCCTGCCGC...GACAATCATTCGGTCCTTTACGTCCGGATGCCGGCATTGCTGCAGAGCCTGGAACAGGCCCGCGGTATCGGCAGCCTCGCAACGCGCCTGAAAAGTCTCGGCGCCGTC...GAACTTCTCATCCTCGATGATTACGGGCTTCAGCCCATCGACGGTAATGCTCCCCATTATCTGCTCGAGATCCTTGAGGGACGATACGGCCGACGCTCGACGCTCGTCACCAGCCAATTCCCCGTAGCCCGATGGCACGAAAAAATCAGC...GACCCCACCTATGCCGACGCAATATTGGATCGCCTGGTTCACAACGCT...CACAGGCTT
TRN  10010101100011011
NAM  Y4PL_RHISN/53-230
ASQ  DRKLAARLRFAKLR-HQAVPEDVDYRSERGLDRALFMKL-IGGDWIDAHDNLAICGPSGVGKSWLACALGHKACR.DDRSVLYQRVPRLFANLALARGDGRYARLQRTLGHV.QLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHEIIG.NPTYADAILDRLVHNA.HRI
DSQ  GATCGCAAGCTTGCCGCACGTCTCAGGTTCGCCAAGCTGCGC---CACCAGGCCGTGCCGGAGGATGTCGATTATAGAAGTGAACGCGGTCTCGATCGCGCCCTGTTCATGAAGCTG---ATCGGCGGCGACTGGATCGATGCCCACGACAATCTTGCCATTTGCGGGCCGTCCGGCGTCGGCAAAAGTTGGTTGGCCTGCGCACTCGGGCACAAAGCGTGTCGT...GATGATCGCTCGGTTCTCTACCAGCGCGTTCCGCGGCTGTTTGCCAACCTTGCTCTGGCTCGCGGCGATGGCCGTTATGCAAGGCTGCAGCGAACCCTCGGGCACGTG...CAGCTCCTGATCCTCGATGACTGGGGCCTGGAGCCGCTCAACGAGCAGGCGCGCCACGATCTTCTGGAGATCCTCGAAGATCGTTACGGACGCCGCTCGACGATCATTACCAGCCAGCTTCCGGTATCAGCCTGGCACGAGATCATCGGC...AATCCAACCTATGCCGATGCCATCCTCGACCGCCTCGTTCACAATGCC...CACCGCATC
TRN  10010101100011001
NAM  Y4BM_RHISN/58-236
ASQ  DKRIRNRLASAKLRFAQACIEDIDFAAARGLDRRNTMAL-AQGQWLTAHEGLIITGHTGTGKSWLACAFGRQAAR.LGHSVLYVRVPRMFEELALARLDGSFPRLIDRLTRV.QLLILDDFGTHTLSDQQRFHLFEIVEERYQRKSTLITAQVPVASWHDLIA.DSTVADAILDRIVHNA.HRI
DSQ  GACAAGCGCATCCGTAACCGGCTCGCCTCCGCCAAGCTACGCTTTGCCCAGGCCTGTATCGAAGATATCGACTTCGCCGCCGCCCGCGGTCTCGACCGGCGCAACACCATGGCGCTC---GCCCAGGGGCAATGGCTCACCGCCCACGAGGGCCTGATCATCACCGGCCACACCGGCACCGGCAAGTCATGGCTGGCCTGTGCCTTCGGCAGGCAAGCGGCCAGG...CTCGGTCACTCCGTGCTCTATGTGCGCGTGCCCCGAATGTTCGAGGAGCTCGCGCTTGCCCGCCTCGACGGCTCCTTCCCCCGCCTCATCGACAGGCTCACCCGCGTC...CAGCTCCTCATCCTCGATGACTTTGGAACCCATACGCTCTCCGATCAGCAGCGCTTTCACCTCTTCGAAATCGTCGAGGAGCGTTATCAGCGAAAGTCCACCCTGATCACAGCTCAGGTTCCCGTGGCAAGCTGGCACGACCTTATTGCC...GACAGCACGGTCGCCGACGCCATACTCGACCGTATCGTCCACAATGCT...CACCGCATC
TRN  10010101100011001
NAM  ISTB_PSEFL/53-231
ASQ  DKRLERLRKQAKLKYASACLEDLDRRRGRTLDERLIATL-ASGDWIRQRHNLLLTGPTGVGKTWFACALGHQACR.QGYSALYLRTPRLLEQLRIAHGDGSFGRTLQQLAKV.DVLILDDWGLAALEENARHDLLEVIDDRAGSRSTILTSQLPSSTGTAGST.TPRWPTPCSIAWYTTP.TES
DSQ  GACAAGCGCCTGGAGCGGCTGCGTAAACAGGCCAAGCTCAAGTACGCCAGCGCCTGCCTGGAAGACCTCGACCGGCGCCGTGGCCGCACGCTGGACGAGCGCCTGATCGCGACCCTG---GCCAGTGGTGACTGGATCCGTCAACGGCACAACCTGCTGCTGACCGGCCCGACCGGCGTCGGCAAGACCTGGTTCGCCTGCGCCCTGGGCCACCAAGCCTGTCGC...CAGGGCTACAGCGCGCTGTACCTGCGCACCCCGCGCCTGCTGGAGCAACTGCGCATCGCCCACGGCGACGGTAGCTTCGGGCGCACCCTGCAACAGCTGGCCAAGGTC...GATGTCTTGATTTTGGACGACTGGGGCCTGGCGGCGCTGGAGGAAAATGCCCGGCATGACCTGCTGGAAGTGATCGACGACCGCGCCGGCAGCCGCTCCACCATCCTGACCAGCCAGCTTCCGTCGAGCACTGGCACGGCTGGATCAACG...ACCCCACGCTGGCCGACGCCTTGCTCGATCGCCTGGTACACAACGCCT...ACCGAATCG
TRN  11011101101011001
NAM  ISTB_BURCE/51-229
ASQ  TRRLERLLRAAKLKNPQACVEDIEYRQTRGLDQRIVATL-AGCDWVRNAQNLILTGPTGAGKTWLACAFGQQACR.QGFSVFYVRVARLFEELKIAHGDGSFTRRLAQLAKI.DVLILDDWGLQDLDQAARNDLLEVLDDRVGTRSTVITSQLPLEHWHAWLQ.DPTLADAILDRLVHQA.HKL
NAM  P96960_PSEAC/242-419
ASQ  DKRLSSRLRQARLKHN-ACLEDIDYRSPRGLDKALILQL-SGGQWLRDGLNLIIGGPTGVGKTWLACALAHQACR.EGYSVRYLRLPRLVEELGLAHGDGRFAKLMSSYAKT.DLLILDDWGLARSPPNSGATCWSYWTTATVSARPSLPGRCRWDNWHELIG.DPTLADAILDRLVHNA.YRI
DSQ  GACAAGCGCCTGAGCAGCCGCCTGCGCCAGGCCCGGCTCAAGCACAAC---GCCTGCCTCGAAGACATCGACTACCGCAGCCCGCGCGGGCTGGATAAGGCGCTGATCCTGCAACTG---AGCGGCGGCCAGTGGTTACGCGACGGCCTCAACCTGATCATCGGCGGCCCCACCGGTGTCGGTAAAACCTGGCTGGCCTGCGCCCTGGCCCACCAGGCCTGCCGA...GAAGGCTACAGCGTGCGTTACCTGCGCTTGCCGCGTTTGGTGGAAGAACTGGGTCTGGCCCATGGCGACGGGCGCTTCGCCAAGCTGATGAGCAGCTACGCCAAGACC...GACCTGCTGATCCTCGATGACTGGGGGTTGGCCCGTTCACCGCCGAACAGTGGTGCGACATGCTGGAGCTACTGGACGACCGCTACGGTCAGTGCTCGACCATCGTTACCAGGCAGATGCCGGTGGGACAACTGGCACGAACTGATCGGC...GATCCGACCCTGGCCGACGCTATCCTCGACCGCCTGGTGCACAACGCT...TACCGGATC
TRN  10010101100011000
NAM  Y4IQ_RHISN/60-238
ASQ  HRRIERHLAEAHLP-PGKTLESFAFDAVPMVSKAQVMAIAAGDSWLAKGANILLFGPPGGGKSHLAAAIGLALIE.NGWRVLFTRTTDLVQKLQVARRELQLESAIAKLDKF.DLLILDDLAYVTKDQAETSVLFELISARYERRSIMITANQPFGEWNRVFP.DPAMTLAAVDRLVHHA.TIF
DSQ  CATCGCAGGATCGAACGTCACCTCGCCGAGGCGCATCTGCCG---CCCGGAAAGACGCTCGAGAGCTTCGCTTTCGACGCCGTGCCCATGGTCTCCAAGGCCCAGGTCATGGCCATTGCCGCCGGCGACAGTTGGCTCGCCAAAGGTGCCAATATCCTCCTGTTCGGTCCGCCGGGCGGCGGAAAGAGCCATCTCGCCGCCGCCATCGGCCTCGCGCTGATCGAG...AATGGTTGGCGGGTGCTGTTCACGCGCACGACCGACCTCGTCCAGAAGCTTCAGGTCGCACGGCGTGAACTCCAGCTCGAATCCGCCATCGCAAAGCTCGACAAGTTC...GATCTGCTCATCCTCGACGATCTGGCCTACGTCACCAAGGACCAGGCCGAAACCAGCGTGCTGTTCGAACTCATCTCCGCAAGATATGAGCGGCGTTCCATCATGATAACCGCCAATCAGCCCTTCGGAGAATGGAACCGCGTCTTTCCG...GACCCGGCCATGACGCTTGCCGCGGTGGACCGACTTGTTCATCACGCA...ACGATCTTC
TRN  10010101100011011
NAM  Q57115_PSEAE/54-231
ASQ  VRSVNYQLRVAKFP-VYRDLVGFDFSQS-LVNEATVKQL-HRCDFMEQAQNVVLIGGPGTGKTHLATAIGTQAVMhLNRRVRFFSTVDLVNALEQEKSSGRQGQIANRLLYA.DLVILDELGYLPFSQTGGALLFHLLSKLYEKTSVILTTNLSFSEWSRVFG.DEKMTTALLDRLTHHC.HIL
DSQ  GTACGTTCGGTGAACTATCAATTGCGGGTGGCCAAGTTCCCC---GTGTATCGGGACTTGGTGGGCTTTGACTTCAGTCAAAGC---CTGGTTAATGAGGCCACGGTCAAACAATTG---CACCGGTGCGACTTCATGGAACAAGCCCAGAACGTGGTGCTGATTGGTGGGCCAGGCACAGGCAAGACTCACCTGGCCACAGCCATTGGTACACAAGCAGTGATGcacTTGAACCGACGGGTGCGTTTCTTCTCCACCGTGGATTTGGTCAATGCACTGGAGCAAGAGAAATCATCTGGGCGTCAGGGACAAATCGCAAACCGTCTGTTGTATGCC...GATTTGGTGATTCTGGATGAGCTGGGATATTTGCCTTTTAGCCAAACCGGTGGGGCACTGCTGTTTCACCTGCTCTCAAAGCTGTACGAAAAAACCAGCGTGATACTGACCACCAACTTGAGCTTCTCGGAATGGAGCCGAGTGTTTGGC...GATGAAAAGATGACAACAGCGTTGTTGGACCGACTAACCCACCACTGC...CACATCCTG
TRN  10010101100011001
NAM  P95447_PSEAC/1-179
ASQ  MRSVSHQMNMAKLP-MHRDLAGFDFSAS-SADARLISEL-ANLSFTDTAQNVVLIGGPGTGKTHLATALAVSGITrHGKRVRFYSTVDLVNLLEREKHDGKAGRIAQALLRM.DLVILDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSSVFG.DAKMTTALLDRLTHHCqHSS
DSQ  ATGCGCTCGGTGAGCCACCAGATGAACATGGCCAAGCTGCCG---ATGCACCGCGATCTGGCCGGCTTCGACTTCAGCGCCTCC---AGCGCCGACGCTCGCTTGATCAGCGAGCTG---GCCAATCTGAGCTTTACCGACACCGCGCAGAACGTGGTGCTGATCGGTGGGCCAGGCACCGGTAAAACCCACCTAGCCACCGCGCTGGCCGTGTCCGGCATCACCcggCACGGTAAGCGCGTGCGCTTCTACTCCACGGTCGATCTGGTCAATTTGCTGGAGCGCGAAAAACACGACGGCAAAGCCGGGCGGATCGCCCAGGCACTGCTGCGCATG...GATCTGGTCATCCTCGACGAACTGGGTTATCTGCCGTTCAGCCAGGCTGGCGGTGCGTTGCTGTTTCACCTGCTGTCCAAGCTGTACGAACACACCAGCGTGGTGATCACCACCAACCTGAGCTTCGCCGAATGGTCGAGCGTGTTCGGC...GACGCCAAGATGACCACCGCCCTGCTGGATCGGCTGACCCACCACTGCcaaCATTCGTCG
TRN  11011101101011011
NAM  P74994_ECOLI/56-235
ASQ  QRKQAMYTRMAAFP-AVKTFEEYDFTFATGAPQKQLQSL-RSLSFIERNENIVLLGPSGVGKTHLAIAMGYEAVR.AGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVMApRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAgDAALTSAMLDRILHHS.HVV
DSQ  CAACGTAAACAGGCGATGTATACCCGAATGGCAGCCTTCCCG---GCGGTGAAAACGTTCGAAGAGTATGACTTCACATTCGCCACCGGAGCACCGCAGAAGCAACTCCAGTCGTTA---CGCTCACTCAGCTTCATAGAACGTAATGAAAATATCGTATTACTGGGGCCATCAGGTGTGGGGAAAACCCATCTGGCAATAGCGATGGGCTATGAAGCAGTCCGT...GCAGGTATCAAAGTTCGCTTCACAACAGCAGCAGATCTGTTACTTCAGTTATCTACGGCACAACGTCAGGGCCGTTATAAAACGACGCTTCAGCGTGGAGTAATGGCCcccCGCCTGCTCATCATTGATGAAATAGGCTATCTGCCGTTCAGTCAGGAAGAAGCAAAGCTGTTCTTCCAGGTCATCGCTAAACGTTACGAAAAGAGCGCAATGATCCTGACATCCAATCTGCCGTTCGGGCAGTGGGATCAAACGTTCGCCggtGATGCAGCACTGACCTCAGCGATGCTGGACCGTATCTTACACCACTCA...CATGTCGTT
TRN  10010101100011000
NAM  ISTB_BACTB/55-232
ASQ  QNMIHSMVKMGAFP-HRKEVDEFDFEFQPSINKQQILDF-ISLRFLEQQENIVFLGPSGVGKTHLATSIGIAAAK.KRTSTYFIKCHDLLQNLKRAKIENRLESRLKHYTKY.KLLIIDEIGYLPIDPEDAKLFFQLIDMRYEKRSTILTTNINFKSWDEVFQ.DPKLANAILDRVLHHA.TVV
DSQ  CAAAATATGATTCATTCTATGGTGAAAATGGGCGCATTTCCT---CATAGAAAGGAGGTTGATGAGTTTGATTTCGAATTCCAGCCGAGTATTAATAAACAACAAATCTTAGATTTT---ATTTCTCTACGTTTCTTAGAGCAACAAGAAAACATAGTATTTTTAGGACCTAGTGGTGTTGGTAAGACCCATTTGGCCACGTCTATTGGTATAGCAGCAGCTAAA...AAGCGAACAAGTACTTATTTTATTAAATGTCATGATTTACTTCAAAATTTAAAACGTGCCAAGATTGAGAATCGCCTAGAATCTCGTTTAAAGCACTATACAAAATAC...AAATTACTTATTATTGATGAAATTGGGTACTTGCCTATTGATCCGGAGGATGCAAAATTATTCTTTCAATTAATCGATATGCGTTATGAAAAGCGTAGTACCATCCTAACGACCAATATCAACTTCAAGTCTTGGGACGAAGTATTCCAG...GACCCTAAACTCGCCAATGCCATACTAGATCGTGTCTTACATCATGCC...ACGGTGGTC
TRN  10010101110011010
NAM  O69925_STRCO/56-233
ASQ  DRRFRNGLRLSKLP-HHKTLEDYDFSFQPDLDPRKVKDL-ATLSFIEDKANVALLGPPGVGKTHIAVALAVAACR.AGYSIYFTSLDDMVRHLKAAEDQGRLISKLTSYLRP.AVLVVDEVGYQPLERAEANLVFQVISKRYEKGSIILTSNKTFGEWGQVFG.DEVLATAILDRLLHHC.EVV
DSQ  GACCGGCGCTTCCGCAACGGCCTGCGGCTGTCGAAGCTGCCG---CACCACAAGACACTGGAGGACTACGACTTCTCCTTCCAGCCCGACCTCGATCCGCGCAAGGTCAAGGACCTG---GCCACCCTCTCCTTCATCGAGGACAAGGCCAATGTCGCTCTGCTCGGGCCGCCCGGGGTCGGCAAGACGCACATCGCCGTCGCCCTCGCGGTCGCGGCCTGCCGG...GCCGGGTACTCGATCTACTTCACCAGCCTCGACGACATGGTCCGCCACCTCAAAGCCGCCGAGGACCAGGGCCGGCTGATCAGCAAGCTCACCAGCTACCTTCGCCCC...GCCGTTCTCGTCGTCGACGAGGTGGGCTACCAACCGCTTGAGCGGGCCGAGGCGAACCTGGTCTTTCAGGTCATCTCCAAGCGTTACGAGAAGGGCTCCATCATCCTGACCTCGAACAAGACCTTCGGTGAGTGGGGCCAGGTCTTTGGC...GACGAGGTCCTGGCCACCGCGATCCTCGACCGCCTCCTGCACCACTGC...GAAGTCGTC
TRN  11011101101011011
NAM  ISTB_PSEAE/51-228
ASQ  QRGMESRLKQARLP-WVKTLEQFDFTFQPGIDRKVVREL-AGLAFVERSENVILLGPPGVGKTHLAIALGVKAVD.AGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYA.RVLILDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFG.DHVLATAILDRLLHHS.TTL
DSQ  CAGCGCGGTATGGAGTCCAGGCTGAAGCAGGCTCGTCTGCCG---TGGGTCAAAACGCTGGAGCAGTTCGACTTTACCTTCCAGCCGGGCATCGACCGTAAGGTTGTCCGGGAACTG---GCTGGTCTGGCGTTCGTGGAGCGCAGCGAAAACGTGATCCTGCTGGGACCTCCTGGTGTCGGAAAAACTCATCTGGCCATAGCTCTTGGCGTGAAAGCGGTGGAT...GCGGGACATCGGGTACTGTTTATGCCACTGGACAGACTGATCGCGACACTGATGAAAGCGAAACAGGAAAACCGGCTGGAGCGTCAGCTGCAGCAACTGAGTTATGCC...CGGGTGTTGATCCTGGATGAAATAGGCTATCTGCCCATGAACAGAGAGGAAGCCAGCCTGTTCTTCCGGCTACTGAACCGTCGATATGAAAAAGCGAGCATCATACTGACGTCAAACAAAGGGTTCGCAGACTGGGGAGAAATGTTCGGA...GATCACGTGCTGGCAACAGCGATACTGGATCGGTTGCTACATCACTCA...ACCACGCTG
TRN  10010101100011001
NAM  ISTB_BACST/52-229
ASQ  ARSIQTLIKLSKLP-YRKTIDTFDFTAQPSVDERRIREL-LTLSFIDRKENILFLGPPGIGKTHLAISIGMEAIA.RGYKTYFITAHDLVNQLRRADQEGKLEKKLRVFVKP.TVLIIDEMGYLKLDPNSAHYLFQVIARRYEHAPIILTSNKSFGEWGEIVG.DSVLATAMLDRLLHHS.IIF
DSQ  GCACGATCGATCCAAACGCTCATCAAGCTGTCCAAACTGCCG---TATCGCAAGACGATCGATACGTTTGATTTTACCGCGCAGCCTTCGGTGGATGAGCGCCGGATTCGAGAACTG---CTTACGTTGTCCTTTATTGACCGGAAAGAAAATATCCTCTTTCTCGGTCCACCGGGTATTGGGAAGACACATCTGGCAATTTCGATTGGAATGGAGGCGATCGCA...AGAGGATATAAAACGTATTTTATTACCGCTCACGATTTGGTCAATCAGTTAAGAAGAGCCGACCAGGAAGGAAAGTTGGAGAAAAAGCTTCGTGTCTTTGTGAAGCCA...ACCGTTCTCATTATTGATGAAATGGGGTATCTAAAACTGGACCCGAACAGCGCTCATTACTTATTTCAAGTGATCGCCCGGCGGTACGAGCATGCCCCGATTATCCTCACCTCCAACAAAAGCTTTGGGGAATGGGGAGAAATCGTGGGA...GACTCGGTTTTGGCGACAGCGATGTTAGATCGATTACTGCATCATTCC...ATCATTTTC
TRN  10010101100011010
NAM  O06369_MYCTU/63-223
ASQ  SHGGEGRIRAARFP-SRKSLEEFDFDHARGLKRDTIAHL-GTLDFVT----LAIG-------------IAIRACQ.AGHRVLFATASQWVDRLAAAHHSGTLQSELIRLARY.PLLVVDEVGYIPFEPEAANLFFQLVSSRYERASLIVTSNKPFGRWGEVFG.DDVVAAAMIDRLVHHA.EVI
DSQ  TCCCACGGCGGCGAAGGACGCATCAGGGCCGCCCGCTTCCCA---TCGCGCAAGTCGTTGGAGGAGTTCGACTTCGACCACGCCCGCGGTCTCAAACGCGACACCATAGCGCATCTG---GGCACCCTGGACTTCGTCACC------------CTAGCAATCGGG---------------------------------------ATCGCGATCCGCGCCTGCCAG...GCCGGCCACCGCGTCCTATTCGCCACCGCCTCGCAATGGGTTGATCGTCTGGCCGCCGCCCACCACAGCGGCACCCTGCAATCTGAACTGATTCGGCTGGCCCGATAC...CCGCTGCTGGTCGTCGACGAAGTGGGCTACATCCCCTTCGAACCCGAAGCCGCCAACCTGTTCTTCCAATTGGTGTCGTCCCGCTACGAACGGGCCAGCCTCATCGTCACGTCAAATAAGCCCTTCGGGCGCTGGGGCGAAGTATTCGGC...GACGACGTCGTAGCCGCGGCCATGATCGACCGACTCGTGCACCACGCC...GAAGTCATC
TRN  10010101100011001
NAM  ISTB2_BACFR/61-238
ASQ  RKSYLTRLKLSGLP-AKYDLDLYDYDRAEGMDNRRLREL-RELVWVNQAYNLLLVGPSGTGKTFIAAGLVYEAVK.AGYEAYLMTLEELLTCLKTKEVSAHAMKTYKRIMKA.RLLAIDDATLFPLKREEAVLLFKLVNDFQERTSLIITANKALTRWLETLE.DEAVTAALLDRLLYCC.EII
DSQ  AGGAAAAGCTACCTGACACGGTTGAAACTCTCCGGACTCCCC---GCCAAATACGATCTGGACCTGTACGACTATGACAGGGCGGAAGGAATGGATAACAGGAGGCTGCGCGAACTG---CGTGAGCTGGTATGGGTGAACCAGGCATACAATCTTCTCCTGGTAGGCCCTTCCGGAACCGGCAAGACCTTTATAGCCGCCGGACTCGTGTATGAAGCCGTAAAA...GCGGGATACGAAGCATATCTGATGACACTGGAGGAGCTGCTCACATGCCTGAAAACGAAAGAGGTCTCCGCACATGCGATGAAAACATACAAGCGGATCATGAAGGCC...CGGCTGCTGGCCATAGACGATGCCACACTGTTCCCTTTGAAAAGAGAAGAAGCCGTGTTGCTGTTCAAACTGGTCAATGACTTCCAGGAAAGGACATCACTCATCATCACGGCAAACAAGGCACTCACCCGTTGGCTGGAAACATTGGAG...GATGAAGCGGTCACAGCCGCCTTGCTTGACAGGCTGCTCTACTGCTGC...GAGATTATC
TRN  10010101100011001
NAM  O07445_RHOER/66-241
ASQ  RANLHTRRKRAGFP---TGKTFGDWDETKSSIPRATQDALRTLEWVGRRECFCVCGPSGTGKSHFTEALGQAAVE.AGLAVSWFTIEDLGALVRRHRADDSIARALTRIIRS.DLIIVDDIGLLPVSEDAAEGFYRLVDAAYERRAIAVSSNLHPSGFDEIMP.-KTLATATVDRLLHHA.HVV
DSQ  CGGGCGAACCTGCACACTCGCCGCAAACGCGCGGGTTTCCCT---------ACCGGCAAGACCTTCGGCGACTGGGACGAAACGAAATCGTCGATTCCCCGCGCCACCCAGGACGCGCTCCGCACCCTGGAGTGGGTCGGGCGGCGTGAATGTTTCTGCGTCTGTGGGCCTTCGGGAACTGGCAAGTCTCACTTCACCGAGGCACTCGGGCAGGCCGCAGTCGAA...GCTGGGCTGGCGGTGTCTTGGTTCACCATCGAAGACCTCGGTGCCCTGGTCCGCCGGCACCGTGCCGACGACTCCATCGCCCGAGCCCTGACGAGGATCATCCGCTCC...GACCTGATCATCGTCGACGACATCGGTCTGCTCCCGGTCTCTGAAGACGCCGCCGAAGGATTCTATCGCCTCGTCGACGCTGCCTACGAACGCCGAGCGATTGCCGTCTCGAGCAACCTGCACCCCTCCGGCTTCGACGAGATCATGCCC...---AAAACATTGGCCACCGCCACCGTTGACCGGCTCCTGCACCATGCG...CACGTCGTC
TRN  10010101100011011
//