EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01679 - UPF0057)
FAM  PF01679
PID  UPF0057
DES  Uncharacterized protein family UPF0057
IPR  IPR000612
ANO  12
ALN  53
AID  0.353412
APH  ((((((((YCU3_CAEEL/6-56:0.42482,LT01_HORVU/4-54:0.43960):0.09920,(Y1169_SYNY3/1-52:0.22039,YQAE_ECOLI/1-51:0.60973):0.24574):0.25983,(YD23_YEAST/11-62:0.59657,YOT0_CAEEL/2-52:0.48621):0.17067):0.22592,PMP3_YEAST/4-54:0.45339):0.78209,YAM5_CAEEL/6-57:0.37752):0.45724,YV31_CAEEL/6-57:0.11886):0.30003,P91491_CAEEL/32-83:0.38253):0.79514,O18038_CAEEL/25-76:0.22645,P92009_CAEEL/25-76:0.11860);
ATP  ((((((((YCU3_CAEEL/6-56,LT01_HORVU/4-54),(Y1169_SYNY3/1-52,YQAE_ECOLI/1-51)),(YD23_YEAST/11-62,YOT0_CAEEL/2-52)),PMP3_YEAST/4-54),YAM5_CAEEL/6-57),YV31_CAEEL/6-57),P91491_CAEEL/32-83),O18038_CAEEL/25-76,P92009_CAEEL/25-76);
ATL  7.7882
DNO  10
DLN  159
DID  0.471647
DPH  (YOT0_CAEEL/2-52:0.22599,((PMP3_YEAST/4-54:0.35864,YD23_YEAST/11-62:0.50637):0.10076,(LT01_HORVU/4-54:0.26136,YQAE_ECOLI/1-51:0.40339):0.25623):0.11434,(YAM5_CAEEL/6-57:0.29884,(((O18038_CAEEL/25-76:0.12767,P92009_CAEEL/25-76:0.21993):0.38121,P91491_CAEEL/32-83:0.24723):0.12110,YV31_CAEEL/6-57:0.20172):0.15122):0.26058);
DTP  (YOT0_CAEEL/2-52,((PMP3_YEAST/4-54,YD23_YEAST/11-62),(LT01_HORVU/4-54,YQAE_ECOLI/1-51)),(YAM5_CAEEL/6-57,(((O18038_CAEEL/25-76,P92009_CAEEL/25-76),P91491_CAEEL/32-83),YV31_CAEEL/6-57)));
DTL  4.23658
RID  0.347183
RPH  (((YQAE_ECOLI/1-51:0.84126,LT01_HORVU/4-54:0.41800):0.24059,(PMP3_YEAST/4-54:0.58471,(YAM5_CAEEL/6-57:0.42929,(((O18038_CAEEL/25-76:0.22741,P92009_CAEEL/25-76:0.12074):0.79342,P91491_CAEEL/32-83:0.39012):0.29744,YV31_CAEEL/6-57:0.12213):0.38964):0.66121):0.11997):0.13934,YD23_YEAST/11-62:0.58653,YOT0_CAEEL/2-52:0.46182);
RTP  (((YQAE_ECOLI/1-51,LT01_HORVU/4-54),(PMP3_YEAST/4-54,(YAM5_CAEEL/6-57,(((O18038_CAEEL/25-76,P92009_CAEEL/25-76),P91491_CAEEL/32-83),YV31_CAEEL/6-57)))),YD23_YEAST/11-62,YOT0_CAEEL/2-52);
RTL  6.82362
LNK  LT01_HORVU/4-54:P68179:Z25537
LNK  O18038_CAEEL/25-76:O18038:Z81116
LNK  P91491_CAEEL/32-83:P91491:U88309
LNK  P92009_CAEEL/25-76:P92009:Z81109
LNK  PMP3_YEAST/4-54:P87284:X91499
LNK  Y1169_SYNY3/1-52:P74805:
LNK  YAM5_CAEEL/6-57:Q17638:U55854
LNK  YCU3_CAEEL/6-56:Q22700:
LNK  YD23_YEAST/11-62:Q07549:Z74171
LNK  YOT0_CAEEL/2-52:P34655:Z22181
LNK  YQAE_ECOLI/1-51:P77240:U00096
LNK  YV31_CAEEL/6-57:Q20516:U39646
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YV31_CAEEL/6-57
ASQ  QQIIELILAIFLPPLAIFIHGNDCNMHVAVNIILCFFF.FVPAVIHALWYCFF
DSQ  CAACAAATCATCGAGTTGATCCTTGCGATCTTCCTTCCACCACTCGCCATCTTCATCCACGGAAACGACTGCAACATGCACGTCGCTGTGAACATCATCCTGTGCTTCTTCTTC...TTCGTGCCAGCCGTCATCCACGCTCTCTGGTACTGCTTCTTC
TRN  11011111101111111
NAM  P91491_CAEEL/32-83
ASQ  KLVLLIILIVIFPPAAVAVHANECNMHVFISLILVFFF.MIPSYIHAIWYCFF
DSQ  AAGCTTGTTCTTCTCATCATCCTCATCGTCATTTTCCCACCAGCAGCAGTAGCCGTCCACGCTAACGAATGCAACATGCACGTCTTCATCTCTCTGATTCTCGTGTTTTTCTTC...ATGATTCCATCCTACATCCACGCCATCTGGTATTGCTTCTTC
TRN  11011111101111111
NAM  P92009_CAEEL/25-76
ASQ  DRLVMALMWLILPPMAVYFKSRGCTKHVCLNVLLYFFL.ILPSYIHATWYCFV
DSQ  GATCGACTTGTTATGGCGCTTATGTGGCTAATTTTGCCACCAATGGCAGTGTACTTCAAAAGTCGAGGATGTACAAAACATGTTTGTCTAAACGTTCTTCTATATTTTTTCTTG...ATCCTTCCGTCTTACATACATGCAACTTGGTATTGTTTTGTA
TRN  10010101110011011
NAM  O18038_CAEEL/25-76
ASQ  DRLVMVLLMLVLPPMAVYFKGRGCTKHVLINIFLYILL.VLPAYKHATWFCFV
DSQ  GATCGACTTGTTATGGTTCTCCTAATGTTGGTTCTCCCGCCAATGGCAGTGTACTTCAAAGGCCGTGGATGTACCAAGCATGTACTAATCAACATCTTTCTCTATATTCTTTTG...GTTCTCCCAGCGTATAAGCATGCAACTTGGTTCTGTTTTGTG
TRN  11011101111011011
NAM  YQAE_ECOLI/1-51
ASQ  MGFWRIVITIILPPLGVLLGKG-FGWAFIINILLTLLG.YIPGLIHAFWVQTR
DSQ  ATGGGTTTCTGGAGAATCGTCATCACCATCATTCTGCCGCCGCTCGGCGTGCTGCTCGGTAAAGGG---TTCGGTTGGGCGTTCATTATTAATATTCTGTTGACACTGCTTGGG...TATATCCCCGGTTTGATTCACGCGTTCTGGGTGCAAACCCGC
TRN  10010101100011011
NAM  Y1169_SYNY3/1-52
ASQ  MDIVKIICAILLPPLGVFLQVG-IGKDFWINLLLTIFGlYILGLVHAIWVIAR
NAM  YOT0_CAEEL/2-52
ASQ  CQILLAILAIFLPPIAVLLDVG-CNCDLLINILLTCLG.IIPGIIHAWYIILC
DSQ  TGCCAGATTCTTCTCGCCATCCTTGCAATTTTCCTTCCGCCAATCGCTGTGCTTCTGGATGTTGGA---TGCAACTGTGACCTCCTCATCAACATTCTTCTCACCTGTCTCGGG...ATCATCCCAGGAATCATTCACGCGTGGTACATCATCCTTTGC
TRN  11011111101111111
NAM  YCU3_CAEEL/6-56
ASQ  TDIPKFICAVLLPPIGVFLEKG-CDYHLAICILLTILG.YIPGIIYACYVILA
NAM  LT01_HORVU/4-54
ASQ  ATVLEVILAIILPPVGVFLRYK-LGVEFWICLLLTILG.YIPGIIYAVYVLVV
DSQ  GCAACAGTCTTGGAGGTGATCCTCGCCATCATTCTGCCACCGGTCGGCGTCTTCCTGCGCTACAAA---CTCGGTGTGGAGTTCTGGATCTGTCTCTTGCTGACCATTCTGGGG...TACATACCGGGGATCATCTACGCGGTGTATGTGCTGGTGGTT
TRN  10010101100011011
NAM  YD23_YEAST/11-62
ASQ  SDFILYIVAFFFPPAAVLLRSGPCSSDFLLNVLLTLLG.FLPGMLHAFYYITI
DSQ  TCTGACTTTATACTGTATATTGTTGCGTTTTTTTTCCCCCCAGCTGCAGTCCTTCTTCGATCTGGGCCTTGTTCATCTGATTTCCTCCTGAATGTATTGCTAACGCTACTGGGA...TTTTTGCCCGGTATGTTACACGCATTCTACTACATCACAATT
TRN  10010111100111000
NAM  PMP3_YEAST/4-54
ASQ  AKIINIILSLFLPPVAVFLARG-WGTDCIVDIILTILA.WFPGMLYALYIVLQ
DSQ  GCCAAGATCATTAACATTATATTATCCCTTTTCTTACCACCAGTCGCCGTTTTTCTAGCCCGTGGG---TGGGGTACTGACTGTATAGTGGATATCATTTTGACCATTTTGGCT...TGGTTCCCAGGTATGCTATATGCCTTGTACATTGTCCTACAA
TRN  10010111110111010
NAM  YAM5_CAEEL/6-57
ASQ  DVIIEVILCIFLPPLAIWWHTKECDINVLIDIIFCLLF.WLPGILYAVYICFF
DSQ  GATGTTATTATTGAGGTCATTCTTTGCATTTTCCTCCCGCCATTAGCAATCTGGTGGCACACAAAAGAATGCGATATCAATGTGCTCATTGATATTATATTTTGCCTGCTCTTC...TGGCTTCCAGGAATACTTTACGCAGTCTACATTTGCTTCTTC
TRN  10010101100011010
//