EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01668 - SmpB)
FAM  PF01668
PID  SmpB
DES  SmpB protein
IPR  IPR000037
ANO  14
ALN  72
AID  0.43248
APH  ((((((((SSRP_AQUAE/6-76:0.37995,SSRP_MYCLE/10-77:0.47950):0.11227,SSRP_SYNY3/9-77:0.41171):0.05408,(SSRP_HELPY/2-70:0.57664,SSRP_ENTHR/7-74:0.08067):0.14357):0.06507,(SSRP_NEIMA/1-69:0.50507,(SSRP_VIBCH/13-79:0.13754,(SSRP_ECOLI/11-79:0.14568,SSRP_HAEIN/11-79:0.11016):0.10961):0.19217):0.34723):0.03863,SSRP_BACSU/7-74:0.15155):0.13329,SSRP_BORBU/5-72:0.53101):0.09516,SSRP_RICPR/6-73:0.37106):0.63361,SSRP_MYCGE/2-69:0.27332,SSRP_MYCPN/2-69:0.22955);
ATP  ((((((((SSRP_AQUAE/6-76,SSRP_MYCLE/10-77),SSRP_SYNY3/9-77),(SSRP_HELPY/2-70,SSRP_ENTHR/7-74)),(SSRP_NEIMA/1-69,(SSRP_VIBCH/13-79,(SSRP_ECOLI/11-79,SSRP_HAEIN/11-79)))),SSRP_BACSU/7-74),SSRP_BORBU/5-72),SSRP_RICPR/6-73),SSRP_MYCGE/2-69,SSRP_MYCPN/2-69);
ATL  6.27541
DNO  13
DLN  216
DID  0.496751
DPH  ((SSRP_HELPY/2-70:0.43271,((SSRP_MYCLE/10-77:0.44437,(((((SSRP_ECOLI/11-79:0.20239,(SSRP_NEIMA/1-69:0.42102,SSRP_HAEIN/11-79:0.15948):0.07804):0.12254,SSRP_VIBCH/13-79:0.14587):0.24980,SSRP_RICPR/6-73:0.39770):0.06314,SSRP_BACSU/7-74:0.27282):0.11635,(SSRP_BORBU/5-72:0.38263,SSRP_AQUAE/6-76:0.22721):0.10621):0.14061):0.10100,SSRP_SYNY3/9-77:0.25568):0.11463):0.38822,SSRP_MYCGE/2-69:0.23235,SSRP_MYCPN/2-69:0.18578);
DTP  ((SSRP_HELPY/2-70,((SSRP_MYCLE/10-77,(((((SSRP_ECOLI/11-79,(SSRP_NEIMA/1-69,SSRP_HAEIN/11-79)),SSRP_VIBCH/13-79),SSRP_RICPR/6-73),SSRP_BACSU/7-74),(SSRP_BORBU/5-72,SSRP_AQUAE/6-76))),SSRP_SYNY3/9-77)),SSRP_MYCGE/2-69,SSRP_MYCPN/2-69);
DTL  5.24055
RID  0.425849
RPH  (SSRP_AQUAE/6-76:0.41399,(SSRP_MYCLE/10-77:0.50936,SSRP_SYNY3/9-77:0.40941):0.01822,((((SSRP_MYCGE/2-69:0.28642,SSRP_MYCPN/2-69:0.21636):0.63211,SSRP_RICPR/6-73:0.33367):0.11579,((SSRP_NEIMA/1-69:0.49525,(SSRP_VIBCH/13-79:0.14689,(SSRP_ECOLI/11-79:0.14365,SSRP_HAEIN/11-79:0.11130):0.10234):0.19452):0.19144,SSRP_HELPY/2-70:0.45333):0.17305):0.05909,(SSRP_BORBU/5-72:0.60261,SSRP_BACSU/7-74:0.12502):0.11615):0.13193);
RTP  (SSRP_AQUAE/6-76,(SSRP_MYCLE/10-77,SSRP_SYNY3/9-77),((((SSRP_MYCGE/2-69,SSRP_MYCPN/2-69),SSRP_RICPR/6-73),((SSRP_NEIMA/1-69,(SSRP_VIBCH/13-79,(SSRP_ECOLI/11-79,SSRP_HAEIN/11-79))),SSRP_HELPY/2-70)),(SSRP_BORBU/5-72,SSRP_BACSU/7-74)));
RTL  5.9819
LNK  SSRP_AQUAE/6-76:O66640:AE000682
LNK  SSRP_BACSU/7-74:O32230:Z99121
LNK  SSRP_BORBU/5-72:O51064:AE001117
LNK  SSRP_ECOLI/11-79:P32052:D12501
LNK  SSRP_ENTHR/7-74:P43659:
LNK  SSRP_HAEIN/11-79:P44967:U32779
LNK  SSRP_HELPY/2-70:O25985:AE000644
LNK  SSRP_MYCGE/2-69:P47305:U39685
LNK  SSRP_MYCLE/10-77:O32881:Z98271
LNK  SSRP_MYCPN/2-69:P75043:AE000010
LNK  SSRP_NEIMA/1-69:Q51111:AL162756
LNK  SSRP_RICPR/6-73:O05968:Y11777
LNK  SSRP_SYNY3/9-77:P74355:D90914
LNK  SSRP_VIBCH/13-79:P52116:AE004170
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SSRP_SYNY3/9-77
ASQ  KVV--SDNRQARFLYEILETYEAGIELQGTEVKSIRA.GKVNLRDGFALLRDGEVWLMNVHISPYDKSSLFF
DSQ  AAAGTTGTC------AGCGATAATCGCCAGGCTCGTTTTCTGTACGAAATCTTAGAGACCTATGAGGCGGGCATCGAGCTGCAGGGTACTGAGGTCAAGTCAATTCGAGCA...GGGAAGGTTAATTTACGGGATGGTTTTGCTCTGCTGCGGGACGGGGAAGTCTGGTTGATGAACGTGCATATTTCGCCCTATGACAAAAGTAGTTTATTTTTT
TRN  11011101101011000
NAM  SSRP_ENTHR/7-74
ASQ  KLI--AQNKKARHDYSIIDTMEAGMVLQGTEIKSIRN.SRINLKDGFVRIRNGEAFLHNVHISPYEQGNI-F
NAM  SSRP_BACSU/7-74
ASQ  KVL--SQNKKANHDYFIEETYETGIVLQGTEIKSIRA.GRVNLKDSFAKIERGEVFLHNMHVSPYEQGNR-Y
DSQ  AAAGTATTA------TCTCAAAATAAGAAAGCCAACCACGATTATTTTATAGAAGAAACCTATGAAACAGGCATCGTTCTGCAAGGAACCGAAATCAAATCGATTCGCGCC...GGCCGCGTAAACCTTAAGGATTCCTTCGCCAAAATCGAACGGGGAGAAGTGTTTCTCCACAATATGCACGTCAGCCCATATGAGCAGGGAAACCGC---TAT
TRN  10010101100011010
NAM  SSRP_HELPY/2-70
ASQ  KLI--ASNKKAYFDYEILETLEAGLALLGSEVKALRQ.TRVNLKDNFVKIIKGEAFLFGVHISYLDTIHAYY
DSQ  AAACTCATT------GCCAGCAACAAAAAAGCCTATTTTGACTATGAAATTTTGGAAACTTTAGAAGCGGGATTAGCGCTTTTAGGCTCTGAAGTGAAGGCTTTGAGGCAA...ACTAGGGTGAATTTAAAGGATAATTTTGTTAAAATAATCAAGGGAGAAGCTTTTTTATTTGGTGTTCATATATCATATTTAGATACAATCCATGCGTATTAC
TRN  10010101110011000
NAM  SSRP_AQUAE/6-76
ASQ  KIIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREkGTVSFKDSFVRIENGEAWLYNLYIAPYKHATI-E
DSQ  AAAATTATCCCTATAGCTGAAAACAAGGAAGCAAAAGCCAAGTACGACATACTTGAGACCTACGAAGCGGGAATAGTCTTGAAAGGTTCCGAGGTAAAATCCCTGAGGGAAaagGGAACCGTTTCCTTTAAGGATAGTTTCGTAAGGATAGAAAACGGAGAGGCGTGGCTCTACAACCTCTACATAGCCCCGTATAAACACGCGACTATA---GAA
TRN  10010101100011011
NAM  SSRP_MYCLE/10-77
ASQ  QIV--ATNRKARHDYAIIELFEAGVALLGTEVKSLRE.GHASLADAFATVDSGEVWLRNMHIPEYQHGSW-T
DSQ  CAGATTGTG------GCCACCAATCGCAAGGCTCGGCACGATTACGCAATCATTGAATTGTTTGAGGCTGGGGTGGCGTTGCTTGGCACCGAGGTGAAAAGTCTGCGGGAG...GGGCATGCGTCGCTGGCCGACGCGTTCGCAACCGTCGACAGCGGTGAAGTGTGGTTGCGAAACATGCACATCCCGGAGTATCAGCATGGTAGCTGG---ACC
TRN  11011101101011011
NAM  SSRP_RICPR/6-73
ASQ  KVI--VQNKKALFNYFIEEILEAGIVLKGSEVQSLRQ.GKASIEESHASDNGHEVFLYNCHITEYEKANR-F
DSQ  AAAGTTATT------GTTCAAAATAAGAAAGCATTGTTCAATTATTTTATTGAAGAAATATTAGAAGCAGGTATTGTATTAAAGGGTAGTGAAGTACAGTCTCTTCGTCAA...GGTAAAGCTTCTATAGAAGAAAGTCACGCATCAGATAATGGACATGAAGTATTTTTGTATAATTGCCATATTACAGAATATGAAAAAGCGAATAGA---TTT
TRN  10010101110011000
NAM  SSRP_BORBU/5-72
ASQ  NLL--LENKKAKFNYFIEEKISCGIVLKGTEVKSIKA.KKLSFNNSFASIKKEELWLENLHVSKYKEGNI-F
DSQ  AATTTGCTT------CTTGAAAACAAAAAAGCAAAATTTAATTACTTTATTGAAGAGAAAATAAGTTGTGGAATAGTGCTAAAAGGAACTGAGGTAAAATCAATAAAGGCA...AAAAAATTATCATTTAACAATAGCTTTGCAAGCATAAAAAAAGAAGAATTGTGGCTTGAAAACTTGCACGTATCAAAATATAAAGAAGGTAATATC---TTC
TRN  10010101110011000
NAM  SSRP_HAEIN/11-79
ASQ  NTI--ALNKRARHDYFIEDEIEAGLELQGWEVKSMRA.GKANISDSYVIFKNGEAFLFGASIQPLNVASTHI
DSQ  AATACTATC------GCACTAAATAAACGTGCAAGACACGATTATTTTATTGAAGATGAAATTGAAGCAGGTCTTGAATTACAAGGCTGGGAAGTCAAATCTATGCGCGCA...GGCAAGGCAAATATTAGTGATAGTTATGTTATTTTTAAAAATGGCGAAGCCTTTTTATTCGGCGCAAGCATTCAGCCATTAAATGTTGCATCAACGCATATT
TRN  10010101110011000
NAM  SSRP_ECOLI/11-79
ASQ  ATI--ALNKRARHEYFIEEEFEAGLALQGWEVKSLRA.GKANISDSYVLLRDGEAFLFGANITPMAVASTHV
DSQ  GCGACCATC------GCGCTTAACAAGCGCGCCCGTCACGAATACTTTATCGAAGAAGAGTTCGAAGCGGGACTTGCCCTGCAAGGCTGGGAAGTTAAATCCCTGCGCGCA...GGAAAAGCCAATATCAGCGACAGCTACGTCCTTCTGCGTGACGGAGAGGCATTTCTGTTTGGCGCTAACATCACGCCAATGGCCGTGGCCTCCACGCATGTG
TRN  11011101101011011
NAM  SSRP_VIBCH/13-79
ASQ  NTI--ALNKKARHEYFIEDEFEAGMELQGWEVKSLRQ.GKANIAESYVYIKDGEAFISGMTIIPLQQAST--
DSQ  AACACTATC------GCGCTGAACAAAAAAGCTCGCCACGAATACTTCATCGAAGATGAATTTGAAGCCGGCATGGAGCTACAAGGCTGGGAAGTCAAATCACTTCGCCAA...GGTAAAGCCAACATTGCAGAAAGCTACGTCTACATCAAAGATGGCGAAGCGTTCATTTCCGGTATGACCATCATTCCGTTGCAGCAAGCCTCCACT------
TRN  11011101101011001
NAM  SSRP_NEIMA/1-69
ASQ  MAI--ANNKKAFHDFFIEDRIEAGLVLEGWEVKAIRA.ARVQLKESYIYWKKDAFYLVGCHITALPTASTHI
DSQ  ATGGCTATT------GCGAACAATAAAAAAGCATTTCACGATTTTTTCATTGAAGACCGGATTGAAGCCGGTTTGGTCTTGGAAGGCTGGGAAGTCAAAGCAATCCGCGCC...GCGCGCGTACAGCTTAAAGAGAGTTATATCTATTGGAAAAAAGACGCGTTTTATCTGGTCGGCTGCCATATTACGGCTTTGCCCACAGCCTCGACACACATT
TRN  11011101101011011
NAM  SSRP_MYCPN/2-69
ASQ  RVL--VNNPRAQYDYYLLTGYCAGLVLKGSEVKSLAL.GQGSLKEAYVFIDKHEVYIKDFSISPYAFSGE-F
DSQ  CGAGTACTT------GTCAACAATCCCAGAGCGCAATATGACTATTACCTTTTAACGGGTTATTGTGCTGGCTTAGTCTTAAAAGGTAGTGAAGTCAAATCGCTAGCTTTA...GGGCAAGGTAGCTTAAAGGAAGCCTATGTTTTTATTGACAAGCACGAGGTCTATATTAAAGATTTTAGCATTTCGCCCTATGCCTTTTCAGGCGAG---TTC
TRN  10010101110011000
NAM  SSRP_MYCGE/2-69
ASQ  LIL--VNNPKAKYDYHLMESYCAGIVLKGSEVKALSL.GQGSLKEAYVFVKNNELFLEQFTIPPYSFAGP-L
DSQ  TTAATTCTT------GTTAACAATCCTAAGGCTAAATATGACTATCATTTAATGGAATCTTATTGTGCTGGAATAGTTTTAAAAGGAAGTGAAGTTAAAGCTTTAAGTTTA...GGTCAAGGTAGTTTAAAAGAAGCTTATGTTTTTGTTAAAAACAATGAGCTTTTTTTAGAACAGTTCACTATTCCACCTTATAGTTTTGCAGGTCCA---TTA
TRN  10010101110011010
//