EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01659 - Luteo_Vpg)
FAM  PF01659
PID  Luteo_Vpg
DES  Luteovirus putative VPg genome linked protein
IPR  IPR001964
ANO  8
ALN  105
AID  0.436833
APH  ((((VPG_BYDVN/49-153:0.35406,VPG_PLRV1/52-156:0.23964):0.11099,(VPG_BWYVF/45-149:0.56012,Q65971_9LUTE/44-147:0.30780):0.09052):0.05779,(Q08404_9LUTE/48-152:0.25582,VPG_BLRV/1-105:0.42818):0.11674):1.10169,VPG_BYDV1/39-143:0.25887,VPG_BYDVR/38-142:0.10440);
ATP  ((((VPG_BYDVN/49-153,VPG_PLRV1/52-156),(VPG_BWYVF/45-149,Q65971_9LUTE/44-147)),(Q08404_9LUTE/48-152,VPG_BLRV/1-105)),VPG_BYDV1/39-143,VPG_BYDVR/38-142);
ATL  3.95263
DNO  8
DLN  315
DID  0.631597
DPH  ((VPG_BYDVN/49-153:0.18414,VPG_PLRV1/52-156:0.14753):0.04667,(VPG_BWYVF/45-149:0.24784,Q65971_9LUTE/44-147:0.15029):0.05828,((VPG_BYDV1/39-143:0.13078,VPG_BYDVR/38-142:0.08964):0.44088,(VPG_BLRV/1-105:0.17509,Q08404_9LUTE/48-152:0.15004):0.06872):0.05746);
DTP  ((VPG_BYDVN/49-153,VPG_PLRV1/52-156),(VPG_BWYVF/45-149,Q65971_9LUTE/44-147),((VPG_BYDV1/39-143,VPG_BYDVR/38-142),(VPG_BLRV/1-105,Q08404_9LUTE/48-152)));
DTL  1.94736
RID  0.436833
RPH  ((((VPG_BYDVN/49-153:0.35406,VPG_PLRV1/52-156:0.23964):0.11099,(VPG_BWYVF/45-149:0.56012,Q65971_9LUTE/44-147:0.30780):0.09052):0.05779,(Q08404_9LUTE/48-152:0.25582,VPG_BLRV/1-105:0.42818):0.11674):1.10169,VPG_BYDV1/39-143:0.25887,VPG_BYDVR/38-142:0.10440);
RTP  ((((VPG_BYDVN/49-153,VPG_PLRV1/52-156),(VPG_BWYVF/45-149,Q65971_9LUTE/44-147)),(Q08404_9LUTE/48-152,VPG_BLRV/1-105)),VPG_BYDV1/39-143,VPG_BYDVR/38-142);
RTL  3.95263
LNK  Q08404_9LUTE/48-152:Q08404:L20835
LNK  Q65971_9LUTE/44-147:Q65971:X76931
LNK  VPG_BLRV/1-105:P19127:X53865
LNK  VPG_BWYVF/45-149:P09511:X13063
LNK  VPG_BYDV1/39-143:P29046:X17260
LNK  VPG_BYDVN/49-153:P27579:D10206
LNK  VPG_BYDVR/38-142:P29047:X17261
LNK  VPG_PLRV1/52-156:P17524:D00530
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VPG_PLRV1/52-156
ASQ  LEFPEDEAQARHSCLQRTTSWATPKEVSPSGRVYQTVRHSRMEYSRPTMSIRSQASYFSSSARPLPPPPVPSLMSWTPIAKYHPSSPTSTSSKLRRAAPKLIKRG
DSQ  CTGGAGTTCCCCGAGGACGAGGCTCAAGCGAGACATTCGTGTTTACAAAGGACAACCTCGTGGGCAACACCCAAGGAAGTTTCACCTTCGGGCCGAGTCTATCAGACTGTCCGGCATTCAAGGATGGAATACTCAAGGCCTACCATGAGTATAAGATCACAAGCATCTTACTTCAGTTCGTCAGCGAGGCCTCTTCCACCTCCTCCGGTTCCATCGCTTATGAGTTGGACCCCCATTGCAAAGTATCATCCCTCCAGTCCTACGTCAACAAGTTCCAAATTACGAAGGGCGGCGCCAAAACTTATCAAGCGCGGA
TRN  10010101100011000
NAM  VPG_BYDVN/49-153
ASQ  LQDLEEEAVARHSFSQRIHSRATPLEVSPSGRLYQSIRHSRMEYSRPTMNIRSQIVSYSSSARPLPQQPAPSLTSWTPIAKHLHSHQQSISSQSPKLVRGASQRR
DSQ  CTCCAAGATCTGGAGGAGGAAGCCGTGGCGAGACATTCGTTTTCTCAAAGGATTCACTCGCGGGCAACTCCTCTGGAAGTATCACCTTCGGGCCGTCTCTATCAGAGTATCCGGCATTCCAGAATGGAGTACTCAAGGCCTACCATGAATATAAGATCACAAATTGTGTCTTACAGTTCGTCAGCGAGGCCTCTTCCACAGCAGCCGGCTCCATCTCTTACGAGTTGGACCCCCATTGCAAAGCATCTTCACTCGCATCAACAATCAATAAGTTCACAATCACCAAAACTGGTGCGCGGAGCTTCCCAGCGAAGA
TRN  10010101100011001
NAM  Q65971_9LUTE/44-147
ASQ  AEL-EEEAQAKHLYFQRTISRAVPQEVSPSGRLFQRAQHSALEYSRPTMNIRSSWSSWSSSPRPLPPPRVPSLMSWTPTASLAPSNPRLINLESPRVDCDVGPLS
DSQ  GCAGAGCTA---GAAGAGGAAGCCCAGGCGAAACATTTGTATTTTCAAAGGACAATCTCACGGGCAGTTCCACAGGAAGTATCACCTTCGGGCCGTCTCTTTCAGAGAGCCCAGCATTCAGCTCTGGAATACTCAAGGCCTACCATGAATATAAGATCATCATGGTCCAGCTGGAGTTCATCTCCGAGGCCTCTTCCACCTCCTCGGGTTCCATCTCTTATGAGTTGGACCCCCACTGCAAGCTTAGCTCCCTCCAATCCACGATTAATAAATTTGGAATCACCAAGAGTGGATTGCGACGTTGGACCGCTAAGC
TRN  10010101100011000
NAM  Q08404_9LUTE/48-152
ASQ  AIFPEDQARLTHSCFQRTASMVVPREVSLSGRLYQNASHSLMEYSRPTMNIRSRVSYYSSSPRPLPPRQVPSLMNLTHTASTPKFNRYSINSVSQRAVRNVSQPE
DSQ  GCTATATTTCCGGAGGATCAGGCAAGGCTCACACATTCGTGTTTTCAAAGGACGGCATCAATGGTAGTTCCAAGGGAAGTATCACTTTCGGGCCGTCTTTATCAGAATGCAAGCCATTCTCTGATGGAATACTCAAGGCCTACCATGAATATAAGATCACGAGTGTCTTATTACAGTTCATCACCGAGGCCTCTTCCACCTCGTCAGGTTCCATCGCTTATGAACTTGACCCACACTGCAAGTACTCCGAAATTCAATCGCTACTCAATAAATTCAGTATCACAAAGAGCGGTTCGAAACGTTTCCCAACCAGAG
TRN  10010101100011001
NAM  VPG_BWYVF/45-149
ASQ  LFLPEEQVRARHLFSQKTISREVPAEQSRSGRVYQTARHSLMECSRPTMSIKSQWSFWSSSPKPLPKIPVPSLTSWTHTVNSTPFPQLSTSSGSQSPGKGRLQRL
DSQ  CTGTTCCTACCAGAGGAGCAGGTTCGAGCGAGACATTTGTTTTCTCAAAAGACAATCTCGCGGGAAGTTCCAGCGGAGCAATCACGTTCGGGCCGAGTCTATCAGACTGCCCGGCATTCTCTAATGGAATGCTCAAGGCCTACCATGAGTATAAAATCTCAATGGTCATTTTGGAGTTCGTCTCCGAAGCCTCTTCCCAAAATTCCGGTTCCATCGCTTACGAGCTGGACCCACACTGTAAACTCAACTCCCTTTCCTCAACTATCAACAAGTTCGGGATCACAAAGCCCGGGAAAAGGGCGTTTACAGCGTCTT
TRN  10010101100011000
NAM  VPG_BLRV/1-105
ASQ  MDLPEDQARFTNSYSLRTTSMETPREVSRSGRLYQSASRSQMAYSRPTMSIISRTSSWRTSPRPLPPPQVPSLMNSILTSRTQQSSPKLTNSASPNLRRKSSLGR
DSQ  ATGGATTTGCCCGAAGATCAAGCCAGGTTCACGAATTCGTATTCTCTAAGGACAACCTCAATGGAAACTCCAAGGGAAGTATCACGTTCGGGCCGTCTCTATCAGAGTGCAAGCCGCTCGCAGATGGCATACTCAAGGCCTACCATGAGTATAATATCACGAACGTCGAGCTGGCGTACATCACCGAGGCCTCTTCCACCTCCTCAGGTTCCATCGCTTATGAACTCGATCCTCACCTCAAGAACACAACAATCCAGTCCAAAATTAACAAATTCAGCATCACCAAATCTGAGAAGAAAAAGTTCTCTCGGAAGG
TRN  10010101100011000
NAM  VPG_BYDVR/38-142
ASQ  ILYLDQQAGLRYSYSQSTTLKPTPPGQSNSAPVYRNAQRFQTEYLSPTTVTRSQVSVLSLSHTRPQLRPALSLLNSTPRANNQPWVATLIPSQSAGPPQRSSEPK
DSQ  ATCCTGTATTTAGACCAACAGGCGGGACTGAGGTATTCGTATTCTCAGTCGACAACCTTAAAGCCAACTCCTCCGGGGCAATCAAATTCGGCCCCAGTCTATCGCAATGCCCAGCGCTTTCAGACGGAATACTTAAGTCCTACCACCGTTACAAGATCACAAGTATCCGTGTTGAGTTTAAGTCACACGCGTCCGCAACTACGGCCGGCGCTATCTTTATTGAACTCGACACCGCGTGCAAACAATCAGCCCTGGGTAGCTACATTAATTCCTTCACAATCAGCAGGACCGCCGCAAAGGTCTTCAGAGCCGAAG
TRN  10010101100011000
NAM  VPG_BYDV1/39-143
ASQ  ILYLDQQAGLRYSYSQSTTLRPTPQGQSSSVPTFRNAQRFQVEYSSPTTFTRSQTSRLSLSHTRPPLQSAQCLLNSTLGAHNQPWVATLTHSPSQNQQPKPSPPN
DSQ  ATCTTATATCTGGACCAGCAGGCAGGACTGAGGTATTCGTATTCTCAGTCAACGACCTTAAGGCCAACTCCTCAGGGACAATCAAGTTCGGTCCCGACCTTTCGCAATGCCCAGCGCTTTCAGGTGGAATACTCAAGTCCTACCACCTTTACAAGATCACAAACGTCAAGGTTGAGTTTAAGTCACACGCGTCCGCCTCTACAGTCGGCGCAATGTTTATTGAACTCGACACTTGGTGCTCACAATCAACCTTGGGTAGCTACATTAACTCATTCACCATCTCAAAATCAGCAACCAAAACCTTCACCGCCCAAC
TRN  10010101100011000
//