EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01638 - DUF24)
FAM  PF01638
PID  DUF24
DES  Transcriptional regulator
IPR  IPR002577
ANO  14
ALN  92
AID  0.400949
APH  ((((((YCKH_BACSU/19-110:0.24641,(((YKVN_BACSU/14-104:0.32347,YTCD_BACSU/16-106:0.24369):0.07773,(YDEP_BACSU/26-116:0.12849,YYBR_BACSU/22-112:0.14317):0.26023):0.10677,(Y1285_METTH/34-124:0.38635,YDZF_BACSU/18-109:0.67253):0.10357):0.06338):0.19341,YTFH_ECOLI/28-118:0.87315):0.09463,P70885_BUTFI/18-108:0.37927):0.14277,(O32238_BACSU/99-189:0.47529,YODB_BACSU/15-105:0.43439):0.31722):0.06487,Y1512_SYNY3/33-123:0.50483):0.36943,Y3095_MYCTU/21-110:0.66836,P71983_MYCTU/16-103:0.61467);
ATP  ((((((YCKH_BACSU/19-110,(((YKVN_BACSU/14-104,YTCD_BACSU/16-106),(YDEP_BACSU/26-116,YYBR_BACSU/22-112)),(Y1285_METTH/34-124,YDZF_BACSU/18-109))),YTFH_ECOLI/28-118),P70885_BUTFI/18-108),(O32238_BACSU/99-189,YODB_BACSU/15-105)),Y1512_SYNY3/33-123),Y3095_MYCTU/21-110,P71983_MYCTU/16-103);
ATL  7.91985
DNO  13
DLN  276
DID  0.471689
DPH  ((((((((Y1285_METTH/34-124:0.35367,P70885_BUTFI/18-108:0.44174):0.09841,YCKH_BACSU/19-110:0.27910):0.06631,((YDEP_BACSU/26-116:0.24257,YYBR_BACSU/22-112:0.15179):0.17784,(YTCD_BACSU/16-106:0.31138,YKVN_BACSU/14-104:0.24873):0.08726):0.04582):0.20090,YDZF_BACSU/18-109:0.49182):0.13854,YODB_BACSU/15-105:0.28584):0.09496,O32238_BACSU/99-189:0.33923):0.17976,Y1512_SYNY3/33-123:0.46803):0.31649,Y3095_MYCTU/21-110:0.46486,P71983_MYCTU/16-103:0.25669);
DTP  ((((((((Y1285_METTH/34-124,P70885_BUTFI/18-108),YCKH_BACSU/19-110),((YDEP_BACSU/26-116,YYBR_BACSU/22-112),(YTCD_BACSU/16-106,YKVN_BACSU/14-104))),YDZF_BACSU/18-109),YODB_BACSU/15-105),O32238_BACSU/99-189),Y1512_SYNY3/33-123),Y3095_MYCTU/21-110,P71983_MYCTU/16-103);
DTL  5.74174
RID  0.411728
RPH  ((((((((YKVN_BACSU/14-104:0.32254,YTCD_BACSU/16-106:0.24491):0.08177,(YDEP_BACSU/26-116:0.12916,YYBR_BACSU/22-112:0.14265):0.25566):0.10256,YCKH_BACSU/19-110:0.28570):0.06557,(Y1285_METTH/34-124:0.40491,YDZF_BACSU/18-109:0.64099):0.07305):0.20265,(O32238_BACSU/99-189:0.46593,YODB_BACSU/15-105:0.45058):0.28845):0.10705,P70885_BUTFI/18-108:0.41921):0.12427,Y1512_SYNY3/33-123:0.47760):0.38686,Y3095_MYCTU/21-110:0.61249,P71983_MYCTU/16-103:0.67284);
RTP  ((((((((YKVN_BACSU/14-104,YTCD_BACSU/16-106),(YDEP_BACSU/26-116,YYBR_BACSU/22-112)),YCKH_BACSU/19-110),(Y1285_METTH/34-124,YDZF_BACSU/18-109)),(O32238_BACSU/99-189,YODB_BACSU/15-105)),P70885_BUTFI/18-108),Y1512_SYNY3/33-123),Y3095_MYCTU/21-110,P71983_MYCTU/16-103);
RTL  7.04346
LNK  O32238_BACSU/99-189:O32238:Z99121
LNK  P70885_BUTFI/18-108:P70885:U44893
LNK  P71983_MYCTU/16-103:P71983:BX842577
LNK  Y1285_METTH/34-124:O27346:AE000894
LNK  Y1512_SYNY3/33-123:P72979:D38599
LNK  Y3095_MYCTU/21-110:O05774:BX842581
LNK  YCKH_BACSU/19-110:P42406:Z99105
LNK  YDEP_BACSU/26-116:P96673:Z99106
LNK  YDZF_BACSU/18-109:O31494:Z99106
LNK  YKVN_BACSU/14-104:O31679:Z99111
LNK  YODB_BACSU/15-105:O34844:AF006665
LNK  YTCD_BACSU/16-106:O34533:AF008220
LNK  YTFH_ECOLI/28-118:P39316:
LNK  YYBR_BACSU/22-112:P37486:D26185
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YYBR_BACSU/22-112
ASQ  VIGGKWKGILFYHMID-GKKRFNEFRRICPSITQRMLTLQLRELEADGIVHREVYHQVPPKVEYSLTEFGRTLEPIVLQMKEWGESNRDVLE
DSQ  GTCATTGGCGGAAAGTGGAAAGGAATTCTTTTTTATCACATGATAGAT---GGCAAGAAACGATTTAATGAGTTTCGGCGAATCTGCCCGAGTATTACTCAAAGAATGCTTACTCTCCAGCTGAGGGAGCTGGAAGCGGACGGCATCGTGCACCGTGAGGTTTATCACCAGGTGCCGCCCAAGGTAGAGTACTCTCTGACGGAATTTGGGCGCACGCTTGAACCGATTGTTTTGCAAATGAAAGAATGGGGAGAATCCAACAGAGACGTGCTGGAA
TRN  10010101100011011
NAM  YDEP_BACSU/26-116
ASQ  IIGGKWKGILLYHLID-GKKRFNEFRKLYPKITQRMLTLQLRELERDGVIHREVYKQVPPKVEYSLTEFGRTLEPVILHMKDWGEKYKDRID
DSQ  ATCATCGGAGGTAAGTGGAAAGGCATTCTTCTTTATCATCTCATTGAC---GGTAAAAAGAGGTTTAATGAGTTTCGAAAACTATACCCAAAAATTACCCAGCGTATGCTCACGCTACAATTAAGAGAATTGGAACGGGATGGCGTGATTCACCGCGAGGTTTATAAACAGGTCCCTCCAAAAGTCGAATACTCTTTAACTGAGTTTGGAAGAACATTAGAACCTGTTATCCTGCACATGAAGGACTGGGGAGAAAAATATAAAGACAGGATTGAT
TRN  10010101100011010
NAM  YCKH_BACSU/19-110
ASQ  VIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLREREQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELID
DSQ  GTGATTGGCGGTAAATGGAAAATGCTCATTTTATGGCATTTAGGAAAAGAAGGCACAAAACGGTTCAATGAATTAAAAACATTGATTCCTGATATTACGCAGAAGATCCTCGTGAATCAGCTGAGAGAGCGTGAGCAGGATATGATTGTTCACAGGGAAGTGTATCCAGTTGTCCCGCCGAAGGTTGAATATTCTCTGACCCCGCACGGAGAAAGCCTCATGCCTATTCTTGAAGCCATGTATGAGTGGGGGAAAGGCTATATGGAATTGATTGAT
TRN  10010101100011010
NAM  YTCD_BACSU/16-106
ASQ  VIGGKWKCVILCHLTH-GKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLCAWGANHINRVY
DSQ  GTGATCGGTGGGAAATGGAAATGCGTCATTTTATGCCATCTGACGCAC---GGAAAAAAACGCACAAGTGAATTAAAACGCCTAATGCCCAATATCACGCAAAAAATGCTGACTCAGCAGCTGCGCGAGCTGGAAGCGGACGGTGTCATTAACCGAATCGTATATAATCAAGTTCCTCCCAAAGTGGAATACGAGCTCAGCGAATACGGCCGCAGCTTAGAAGGGATTTTAGATATGCTGTGTGCTTGGGGAGCGAATCATATTAACAGAGTGTAC
TRN  10010101100011010
NAM  YKVN_BACSU/14-104
ASQ  VIGGKWKGLVLYFLMN-GPKRTSELKRIIPNITQKMLIQTLRELEASGLVSRKMYNQVPPKVEYSSTELGESLKPILQELCQWGGYYAEQEY
DSQ  GTTATTGGCGGAAAATGGAAAGGCCTTGTATTATACTTTTTAATGAAT---GGACCAAAGAGAACGAGTGAATTAAAGCGCATTATCCCAAATATAACTCAGAAAATGCTGATTCAAACACTTAGAGAGCTTGAAGCCAGTGGACTTGTGAGCAGAAAGATGTATAATCAAGTACCGCCGAAGGTTGAATATTCATCCACTGAACTTGGAGAATCTCTTAAACCTATCTTGCAGGAGCTCTGTCAATGGGGAGGCTATTATGCGGAGCAAGAGTAT
TRN  10010101100011000
NAM  Y1285_METTH/34-124
ASQ  EIGGKWKSLVLCTLKD-GKLRFSEINRRIPKITQRMLTRTLRELESSGLINREVYPEVPPRVEYCLTEKGKSVIPILDALCEWGKMYGSHQE
DSQ  GAGATAGGTGGTAAATGGAAATCACTGGTCCTCTGCACCCTGAAGGAT---GGTAAACTACGCTTCAGTGAAATAAACCGGAGGATCCCAAAAATAACACAGCGGATGCTCACAAGGACACTCCGTGAACTTGAATCCAGTGGACTGATAAACAGAGAGGTCTACCCTGAGGTGCCCCCCAGGGTGGAGTACTGCCTCACAGAGAAGGGAAAATCCGTCATACCCATACTGGACGCCCTCTGCGAATGGGGTAAAATGTACGGGTCCCACCAGGAG
TRN  10010101100011001
NAM  P70885_BUTFI/18-108
ASQ  LIGSKWKLLIIRNLLV-RPWRFNELKNNLEGISQKVLTDSLRSMEEDGIITRTVYPEVPPRVEYSLSELGESMRPIIKAMEQWGTEYKETLD
DSQ  TTAATTGGTAGTAAATGGAAATTACTTATTATTAGAAATCTCCTTGTT---CGTCCTTGGAGATTTAATGAATTAAAGAATAATTTAGAGGGAATCAGTCAAAAGGTACTCACCGATTCTCTTCGTTCTATGGAAGAAGATGGAATAATAACAAGAACTGTTTATCCAGAGGTGCCACCTAGAGTAGAGTATTCTCTTTCAGAACTAGGTGAATCTATGCGCCCCATCATTAAAGCTATGGAACAATGGGGCACAGAATATAAAGAAACACTAGAT
TRN  10010101110011000
NAM  YDZF_BACSU/18-109
ASQ  LIGGKWKMRILYELGCEKTMRYGELKRAMPFITHKMLSAQLKELQTDGLIHRSEVSHTPLKVEYSLSDRGRSLYPLIDEMCKWGMAQGGPHM
DSQ  CTTATAGGGGGCAAATGGAAAATGAGAATTCTCTATGAGTTAGGGTGTGAAAAAACGATGAGATACGGCGAGCTGAAAAGGGCTATGCCCTTCATCACCCATAAAATGTTAAGCGCACAGCTTAAGGAATTGCAAACTGACGGCCTTATTCATCGGTCTGAGGTTTCTCACACCCCACTGAAAGTAGAGTATTCGTTATCTGACAGAGGGCGATCTTTGTATCCCCTCATAGATGAGATGTGTAAGTGGGGAATGGCACAAGGAGGGCCTCATATG
TRN  10010101100011010
NAM  Y1512_SYNY3/33-123
ASQ  LLDNKWSILVLRELFK-GQRRTGQLLDALPGCSTKTLTLRLRQLETHGIINRDVYPEIPPRVEYSLTARGREIQPVLIAMHKLGSDWLEQES
DSQ  TTACTTGATAATAAGTGGTCTATTTTGGTGTTGCGGGAACTGTTCAAG---GGACAACGACGCACGGGGCAGTTGTTAGATGCCTTGCCCGGTTGTAGCACTAAAACGTTAACCCTAAGGCTTAGGCAACTAGAAACCCACGGCATTATCAATCGGGATGTGTACCCAGAAATTCCCCCTAGGGTGGAGTATTCCCTCACGGCCAGGGGTAGGGAAATTCAGCCAGTGCTGATTGCCATGCACAAACTAGGTTCCGACTGGTTAGAGCAAGAATCC
TRN  10010101100011010
NAM  YODB_BACSU/15-105
ASQ  LLGKRWNGLIIHVLMD-GPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEPGD
DSQ  TTGCTGGGAAAACGATGGAACGGTCTGATCATCCATGTGCTAATGGAT---GGGCCGAAACGGTTTAAAGAGATAACGGAAACAATACCGATGATCAGCCAAAAAATGTTGGCAGAGCGCTTGAAGGAGCTTGAACAAAACGAGATTGTCGAACGGCAGGTTCTCCCTGAAACGCCGGTCAAAGTCATCTACACGCTGACTGAAAAAGGAACAGCGCTTCAAGCTGTATTTCAAGAAATGCAGGCATGGGCCGATCAATTTTGCGAGCCTGGTGAC
TRN  10010101100011011
NAM  O32238_BACSU/99-189
ASQ  ILSKRWVALIVFQLLN-GSQRFSEIEAALPNLSGRVLSERLKELELEGVVKRDVIPETPVRIEYSLTDKGKALAPILGEISKWATEWIDPSF
DSQ  ATCTTAAGTAAACGCTGGGTCGCTTTAATCGTATTTCAGCTCTTGAAC---GGGTCGCAGCGATTTAGCGAAATTGAAGCAGCACTTCCAAATCTAAGCGGCAGAGTTCTGTCAGAACGGCTGAAAGAACTTGAGCTTGAAGGAGTAGTGAAGCGGGATGTCATCCCTGAAACTCCGGTTCGCATCGAATATTCATTGACTGATAAAGGAAAGGCACTAGCACCCATATTAGGTGAGATTTCTAAATGGGCGACTGAATGGATTGACCCTTCCTTT
TRN  10010101100011000
NAM  YTFH_ECOLI/28-118
ASQ  HVTSRWGVLILVALRE-GTHRFSDLRRKIGGVSEKMLAQSLQALEQDGFLNRIAYPVVPPHVEYSLTPLGEQVSEKVAALADWIELNLPEVL
NAM  P71983_MYCTU/16-103
ASQ  LLGDRWTLLIVRELLF-GPLRFTEIERGLPGISRSVLAQRLRRLQHDRIIEAVPEHTGGG---YRFTVAGEELRPVLQTLGDWVSRWLMADP
DSQ  CTGCTGGGGGACCGCTGGACGCTGCTAATCGTGCGGGAGCTGCTCTTC---GGCCCGCTGCGGTTCACCGAAATCGAGCGGGGCCTGCCCGGCATCTCCCGCTCGGTGCTGGCCCAGCGGCTACGCCGACTTCAGCACGACCGCATCATCGAAGCGGTCCCCGAACACACGGGCGGGGGC---------TATCGGTTCACGGTGGCCGGCGAGGAGCTACGCCCCGTGCTGCAGACCCTGGGGGACTGGGTCTCCCGTTGGTTGATGGCCGACCCC
TRN  11011111101111111
NAM  Y3095_MYCTU/21-110
ASQ  LVGERWTLLILREAFF-GVRRFGQLARNL-GIPRPTLSSRLRMLVEVGLFDRVPYSSDPERHEYRLTEAGRDLFAAIVVLMQWGDEYLPRPE
DSQ  CTAGTCGGTGAACGCTGGACGCTGCTTATCCTGCGTGAGGCGTTCTTC---GGGGTGCGGCGGTTCGGTCAGCTCGCGCGGAACCTT---GGCATTCCGCGGCCCACGCTGTCCTCGCGGCTGCGGATGCTCGTCGAGGTGGGTCTTTTTGACCGGGTGCCATATTCCTCCGACCCCGAGCGACACGAGTACCGGCTCACCGAAGCGGGCCGCGATCTGTTCGCCGCGATCGTCGTCCTCATGCAGTGGGGGGATGAGTACTTGCCACGCCCAGAA
TRN  11011111101111111
//