EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01630 - Glyco_hydro_56)
FAM  PF01630
PID  Glyco_hydro_56
DES  Hyaluronidase
IPR  IPR001968
ANO  12
ALN  349
AID  0.421178
APH  ((((((((HYAL1_HUMAN/38-374:0.14995,HYAL1_RABIT/38-378:0.17063):0.10330,(HYAL1_MOUSE/38-374:0.11267,HYAL1_RAT/38-374:0.11976):0.27276):0.07832,Q29152_VULVU/38-375:0.24419):0.29849,HYAL2_HUMAN/25-363:0.46059):0.12268,O43820_HUMAN/21-354:0.58363):0.07500,(Q12794_HUMAN/22-356:0.12391,O70229_MOUSE/50-384:0.17227):0.37695):0.39250,Q22675_CAEEL/25-360:0.78636):0.50688,HUGA_APIME/36-368:0.30468,HUGA_DOLMA/1-331:0.35680);
ATP  ((((((((HYAL1_HUMAN/38-374,HYAL1_RABIT/38-378),(HYAL1_MOUSE/38-374,HYAL1_RAT/38-374)),Q29152_VULVU/38-375),HYAL2_HUMAN/25-363),O43820_HUMAN/21-354),(Q12794_HUMAN/22-356,O70229_MOUSE/50-384)),Q22675_CAEEL/25-360),HUGA_APIME/36-368,HUGA_DOLMA/1-331);
ATL  5.82195
DNO  12
DLN  1047
DID  0.500716
DPH  (((((O43820_HUMAN/21-354:0.37726,(Q12794_HUMAN/22-356:0.06177,O70229_MOUSE/50-384:0.14211):0.27825):0.09451,HYAL2_HUMAN/25-363:0.34531):0.16492,(Q22675_CAEEL/25-360:0.61963,(HUGA_DOLMA/1-331:0.28805,HUGA_APIME/36-368:0.30665):0.33044):0.18797):0.25902,(HYAL1_MOUSE/38-374:0.06444,HYAL1_RAT/38-374:0.07802):0.17012):0.05369,(HYAL1_HUMAN/38-374:0.09437,HYAL1_RABIT/38-378:0.13528):0.03857,Q29152_VULVU/38-375:0.19299);
DTP  (((((O43820_HUMAN/21-354,(Q12794_HUMAN/22-356,O70229_MOUSE/50-384)),HYAL2_HUMAN/25-363),(Q22675_CAEEL/25-360,(HUGA_DOLMA/1-331,HUGA_APIME/36-368))),(HYAL1_MOUSE/38-374,HYAL1_RAT/38-374)),(HYAL1_HUMAN/38-374,HYAL1_RABIT/38-378),Q29152_VULVU/38-375);
DTL  4.28337
RID  0.421178
RPH  ((((((((HYAL1_HUMAN/38-374:0.14995,HYAL1_RABIT/38-378:0.17063):0.10330,(HYAL1_MOUSE/38-374:0.11267,HYAL1_RAT/38-374:0.11976):0.27276):0.07832,Q29152_VULVU/38-375:0.24419):0.29849,HYAL2_HUMAN/25-363:0.46059):0.12268,O43820_HUMAN/21-354:0.58363):0.07500,(Q12794_HUMAN/22-356:0.12391,O70229_MOUSE/50-384:0.17227):0.37695):0.39250,Q22675_CAEEL/25-360:0.78636):0.50688,HUGA_APIME/36-368:0.30468,HUGA_DOLMA/1-331:0.35680);
RTP  ((((((((HYAL1_HUMAN/38-374,HYAL1_RABIT/38-378),(HYAL1_MOUSE/38-374,HYAL1_RAT/38-374)),Q29152_VULVU/38-375),HYAL2_HUMAN/25-363),O43820_HUMAN/21-354),(Q12794_HUMAN/22-356,O70229_MOUSE/50-384)),Q22675_CAEEL/25-360),HUGA_APIME/36-368,HUGA_DOLMA/1-331);
RTL  5.82195
LNK  HUGA_APIME/36-368:Q08169:L10710
LNK  HUGA_DOLMA/1-331:P49371:L34548
LNK  HYAL1_HUMAN/38-374:P38567:X84347
LNK  HYAL1_MOUSE/38-374:P48794:AY228460
LNK  HYAL1_RABIT/38-378:P38566:U09183
LNK  HYAL1_RAT/38-374:Q62803:X89999
LNK  HYAL2_HUMAN/25-363:Q12891:U09577
LNK  O43820_HUMAN/21-354:O43820:U73167
LNK  O70229_MOUSE/50-384:O70229:AF011567
LNK  Q12794_HUMAN/22-356:Q12794:U03056
LNK  Q22675_CAEEL/25-360:Q22675:Z49071
LNK  Q29152_VULVU/38-375:Q29152:U41412
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  HYAL1_RAT/38-374
ASQ  YRATPVLSDTTFVWVWNVPTEACVENVTEPIDLSF.FSLIGSPRKTAIG-QPVTLFYVDRLGNYPHIDAQQ----TEHHGGIPQKGDLTTHLVKAKEDVERYIPT-DKLGLAIIDWEEWRPTWMRNWTPKDIYRNKSIELVQAADPAINITEATVRAKAQFEGAAKEFMEGTLKLGKHIRPKHLWGFYLFPDCYN-NKFQVDN--YDGQCPDVEKKRNDDLDWLWKESTGLYPSVYLKKDLKSSRKA-TLY-VRYRVLESIRVSKVSDESNPVPIFVYIRLVFTDHVSEYLLEDDLVNTIGEIVAQGTSGIIIWDAMSLAQRSAGCPILRQYMKTTLNPYIVNVTLAAK
DSQ  TATAGGGCAACACCAGTTCTGTCAGATACAACTTTCGTTTGGGTCTGGAATGTTCCAACTGAAGCTTGTGTAGAAAACGTTACTGAACCAATAGATCTGAGCTTC...TTCTCTTTAATTGGAAGCCCCCGGAAAACTGCCATAGGG---CAGCCTGTCACATTATTTTATGTTGATCGACTTGGTAACTATCCTCACATAGATGCACAGCAA------------ACAGAACATCATGGAGGAATACCTCAGAAGGGGGATTTGACAACTCATTTGGTGAAAGCTAAGGAAGACGTAGAGCGTTACATACCAACA---GACAAACTGGGTTTAGCTATCATTGACTGGGAAGAATGGAGGCCTACCTGGATGAGAAACTGGACACCTAAGGATATTTACAGGAATAAGTCTATTGAATTGGTCCAGGCAGCTGATCCAGCAATTAATATCACAGAAGCTACTGTGAGAGCCAAAGCACAATTTGAAGGGGCAGCTAAAGAGTTTATGGAAGGGACTTTAAAATTGGGGAAACATATTCGACCAAAGCACTTATGGGGTTTTTATCTATTTCCTGATTGTTATAAC---AATAAATTTCAAGTCGATAAC------TATGATGGCCAATGCCCTGATGTGGAAAAGAAACGAAACGATGATCTTGACTGGCTATGGAAAGAAAGCACGGGCCTTTACCCATCTGTCTATTTGAAGAAAGATTTGAAGTCGAGTCGAAAAGCA---ACCCTTTAT---GTCCGCTACCGAGTTTTAGAATCTATCAGAGTGTCCAAAGTTTCAGATGAATCGAATCCAGTTCCAATTTTTGTCTATATCCGTCTTGTTTTCACTGATCATGTCTCTGAATACCTTCTAGAGGATGATCTTGTGAATACAATTGGTGAAATTGTTGCTCAGGGTACCTCTGGAATTATAATATGGGATGCTATGTCTTTAGCACAACGTTCGGCAGGTTGCCCAATCCTACGTCAATACATGAAGACAACCCTGAATCCATACATAGTCAATGTCACCCTAGCAGCCAAA
TRN  10010101100011000
NAM  HYAL1_MOUSE/38-374
ASQ  YRAAPILSNTTFLWIWNVPTERCVGNVNDPIDLSF.FSLIGSPRKTATG-QPVTLFYVDRLGLYPHIDANQ----AEHYGGIPQRGDYQAHLRKAKTDIEHYIPD-DKLGLAIIDWEEWRPTWLRNWKPKDNYRNKSIELVQSTNPGLSITEATQKAIQQFEEAGRKFMEGTLHLGKFLRPNQLWGYYLFPDCYN-NKFQDPK--YDGQCPAVEKKRNDNLKWLWKASTGLYPSVYLKKDLKSNRQA-TLY-VRYRVVEAIRVSKVGNASDPVPIFVYIRLVFTDRTSEYLLEDDLVNTIGEIVALGTSGIIIWDAMSLAQRAAGCPILHKYMQTTLNPYIVNVTLAAK
DSQ  TATAGGGCAGCACCAATTTTATCAAATACAACTTTCCTTTGGATTTGGAATGTCCCAACTGAACGTTGTGTAGGAAATGTTAATGATCCAATAGATCTGAGCTTC...TTCTCTTTAATTGGAAGCCCCCGGAAAACTGCCACAGGG---CAACCTGTCACATTATTTTATGTTGATCGACTTGGTTTGTATCCTCACATAGATGCAAACCAA------------GCAGAACATTATGGAGGAATACCTCAGAGGGGCGATTATCAAGCTCATTTGCGCAAAGCTAAGACTGACATAGAGCATTACATTCCAGAC---GACAAATTGGGCTTAGCTATCATTGACTGGGAAGAATGGAGGCCTACCTGGTTGAGAAACTGGAAACCTAAGGATAACTACAGGAATAAGTCTATTGAATTGGTCCAATCAACTAATCCAGGACTTAGTATCACAGAAGCCACCCAGAAAGCCATACAACAATTTGAAGAGGCAGGAAGGAAGTTTATGGAAGGAACTTTACACCTGGGGAAATTCCTTCGACCAAACCAGCTATGGGGTTATTATCTATTTCCTGATTGTTATAAC---AATAAGTTTCAAGACCCTAAG------TATGATGGGCAGTGCCCTGCTGTGGAAAAGAAAAGAAATGATAATCTTAAATGGCTATGGAAAGCAAGCACCGGCCTTTACCCATCTGTCTATTTGAAGAAAGACTTGAAGTCCAATCGACAAGCT---ACCCTCTAT---GTCCGCTACCGAGTTGTGGAAGCTATCAGAGTGTCCAAGGTTGGGAATGCATCGGATCCAGTCCCGATTTTTGTCTATATCCGTCTTGTTTTTACTGATCGTACCTCTGAATACCTTCTAGAGGATGACCTTGTGAATACAATTGGTGAAATTGTTGCTCTGGGTACCTCTGGAATTATAATATGGGATGCTATGAGTTTAGCACAACGTGCGGCAGGTTGCCCAATCCTACATAAATACATGCAGACGACCCTGAATCCATACATAGTCAATGTTACCCTAGCAGCCAAA
TRN  10010101100011000
NAM  Q29152_VULVU/38-375
ASQ  FRAPPFIPNVSFLWGWNAPTELCAKRFNVQLDLNL.FSLIGSPLKTVVG-QGIAIFYADRLGYYPHINKTTG---KHVNGGIPQLGSLKKHLDKAKKDISHYIET-DSMGLAVIDWDSWRPNWARNWRPKHIYKEQSIDLAQQQHIHLNLTEVTQIAQADFEKAARCFMQETLKLGKFLRPNYLWGFYLYPDCYN-YNYKNPN--YNGSCYDIEERRNDEIDWLWKESTALFPSIYLKSKLKSSPFT-ALY-VRNRVLEAIRVSKVKDIKHPLPIFVYARPVFTDVLLTYLTEDDLVNTIGESVSLGVSGIVMWGSLNLTENVQICTELDTYIKNKLNPYIINVTLAAK
DSQ  TTCAGAGCACCCCCTTTCATCCCAAATGTTTCTTTCCTCTGGGGCTGGAATGCCCCCACTGAACTTTGTGCTAAAAGGTTTAACGTGCAGCTAGATCTGAACCTT...TTCTCTCTGATAGGAAGCCCTCTAAAAACCGTCGTAGGA---CAAGGCATTGCAATATTTTATGCTGACAGACTGGGCTACTATCCCCACATAAATAAAACGACTGGC---------AAACATGTGAATGGAGGAATCCCCCAATTGGGATCCTTAAAAAAGCACTTGGACAAAGCCAAGAAAGATATTTCCCATTACATAGAAACA---GACAGCATGGGCTTGGCTGTCATTGACTGGGACTCCTGGAGGCCTAACTGGGCAAGAAACTGGAGACCTAAACATATATACAAGGAACAGTCTATTGACTTGGCTCAGCAACAACATATACACCTTAATCTCACAGAGGTCACCCAGATAGCCCAGGCAGATTTTGAAAAGGCAGCAAGGTGTTTCATGCAAGAGACTTTAAAGTTGGGAAAGTTCCTTCGGCCAAATTATTTATGGGGTTTTTATCTTTATCCTGATTGCTACAAT---TATAATTATAAAAATCCCAAT------TACAATGGAAGTTGCTATGATATAGAAGAGAGAAGAAATGATGAGATCGACTGGTTGTGGAAGGAAAGTACAGCCCTTTTCCCATCCATTTATTTGAAGAGCAAACTAAAATCTTCTCCATTCACT---GCTCTTTAT---GTCCGCAATCGTGTTTTGGAAGCCATTCGGGTTTCTAAAGTAAAAGATATTAAACATCCGCTTCCGATCTTTGTATATGCCCGTCCAGTTTTTACTGATGTGTTGCTGACATATCTTACAGAGGATGATCTTGTGAATACAATCGGTGAATCAGTTTCTCTAGGTGTCTCTGGAATAGTAATGTGGGGAAGCCTCAATTTAACCGAAAATGTGCAAATTTGCACAGAGCTAGACACTTACATAAAGAATAAGCTGAATCCTTACATAATCAACGTCACTCTAGCAGCCAAA
TRN  10010101100011000
NAM  HYAL1_RABIT/38-378
ASQ  FRAPPVIPNVPFLWAWNAPTEFCLGKSGEPLDMSL.FSLFGSPRKNKTG-QGITIFYVDRLGYYPYIDPHTG---AIVHGRIPQLGPLQQHLTKLRQEILYYMPK-DNVGLAVIDWEEWLPTWLRNWKPKDIYRIKSIELVKSQHPQYNHSYATEKAKRDFEKAGKDFMEETLKLGRLLRPNHLWGYYLFPDCYN-HHYDKPN-LYKGSCFDIEKKRNDDLSWLWKESTALFPSVYLTSRARSATALSKLYVVRNRVHEAIRVSKIPDDKSPLPNFVYTRLVFTDQIFQFLSHHDLVYTIGEIVALGASGIVVWGSQSLARSMKSCLHLDNYMKTILNPYLINVTLAAK
DSQ  TTCAGAGCACCTCCTGTTATCCCAAATGTGCCCTTTTTGTGGGCCTGGAATGCCCCAACTGAATTTTGTCTTGGAAAGTCTGGTGAACCACTAGATATGAGCCTG...TTCTCTTTATTTGGAAGTCCTCGAAAAAACAAGACAGGA---CAAGGCATTACAATATTCTATGTTGATAGACTTGGCTACTATCCTTACATAGATCCTCACACAGGT---------GCGATTGTGCATGGACGAATTCCCCAACTGGGGCCCTTACAACAGCATTTGACAAAGCTAAGGCAAGAGATTTTATATTATATGCCAAAA---GACAATGTAGGTTTGGCTGTCATTGACTGGGAAGAGTGGCTTCCCACCTGGCTAAGAAACTGGAAGCCTAAGGATATTTACAGGATTAAGTCTATTGAGTTGGTTAAGAGCCAGCATCCACAGTATAATCACTCATATGCTACTGAGAAAGCTAAGAGAGACTTTGAAAAGGCAGGGAAGGATTTCATGGAAGAGACTTTAAAGTTGGGAAGATTACTTCGGCCAAATCACTTGTGGGGTTATTATCTTTTTCCTGATTGTTACAAC---CATCACTATGATAAACCCAAC---TTATATAAAGGGAGTTGTTTTGATATAGAAAAGAAGAGAAATGATGATCTCAGCTGGTTGTGGAAGGAAAGCACTGCCCTTTTCCCATCCGTTTATTTGACCAGTCGAGCAAGATCAGCTACAGCTCTCTCAAAGCTCTATGTTGTCCGTAATCGTGTTCACGAGGCCATAAGGGTTTCTAAAATACCTGATGACAAAAGTCCACTTCCGAATTTTGTGTATACTCGACTAGTTTTTACTGATCAAATATTTCAGTTCCTTTCTCACCATGACCTTGTGTATACAATTGGTGAAATTGTTGCTCTGGGGGCCTCTGGAATTGTAGTATGGGGAAGCCAATCTTTAGCACGAAGTATGAAATCTTGCCTGCACCTAGATAATTATATGAAGACTATACTGAATCCTTACTTAATCAATGTCACCCTAGCAGCCAAA
TRN  10010101100011000
NAM  HYAL1_HUMAN/38-374
ASQ  FRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDMSL.FSFIGSPRINATG-QGVTIFYVDRLGYYPYIDSITG---VTVNGGIPQKISLQDHLDKAKKDITFYMPV-DNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPDCYN-HHYKKPG--YNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAAT--LY-VRNRVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKSCLLLDNYMETILNPYIINVTLAAK
DSQ  TTCAGAGCACCTCCTGTTATTCCAAATGTGCCTTTCCTCTGGGCCTGGAATGCCCCAAGTGAATTTTGTCTTGGAAAATTTGATGAGCCACTAGATATGAGCCTC...TTCTCTTTCATAGGAAGCCCCCGAATAAACGCCACCGGG---CAAGGAGTTACAATATTTTATGTTGATAGACTTGGCTACTATCCTTACATAGATTCAATCACAGGA---------GTAACTGTGAATGGAGGAATCCCCCAGAAGATTTCCTTACAAGACCATCTGGACAAAGCTAAGAAAGACATTACATTTTATATGCCAGTA---GACAATTTGGGAATGGCTGTTATTGACTGGGAAGAATGGAGACCCACTTGGGCAAGAAACTGGAAACCTAAAGATGTTTACAAGAATAGGTCTATTGAATTGGTTCAGCAACAAAATGTACAACTTAGTCTCACAGAGGCCACTGAGAAAGCAAAACAAGAATTTGAAAAGGCAGGGAAGGATTTCCTGGTAGAGACTATAAAATTGGGAAAATTACTTCGGCCAAATCACTTGTGGGGTTATTATCTTTTTCCGGATTGTTACAAC---CATCACTATAAGAAACCCGGT------TACAATGGAAGTTGCTTCAATGTAGAAATAAAAAGAAATGATGATCTCAGCTGGTTGTGGAATGAAAGCACTGCTCTTTACCCATCCATTTATTTGAACACTCAGCAGTCTCCTGTAGCTGCTACA------CTCTAT---GTGCGCAATCGAGTTCGGGAAGCCATCAGAGTTTCCAAAATACCTGATGCAAAAAGTCCACTTCCGGTTTTTGCATATACCCGCATAGTTTTTACTGATCAAGTTTTGAAATTCCTTTCTCAAGATGAACTTGTGTATACATTTGGCGAAACTGTTGCTCTGGGTGCTTCTGGAATTGTAATATGGGGAACCCTCAGTATAATGCGAAGTATGAAATCTTGCTTGCTCCTAGACAATTACATGGAGACTATACTGAATCCTTACATAATCAACGTCACACTAGCAGCCAAA
TRN  10010101100011000
NAM  O70229_MOUSE/50-384
ASQ  CRGS-VVSNRPFITVWNGDTHWCLTEYGVDVDVSV.FDVVANKEQSFQG-SNMTIFYREELGTYPYYTPTG----EPVFGGLPQNASLVTHLAHTFQDIKAAMPEPDFSGLAVIDWEAWRPRWAFNWDSKDIYRQRSMELVQAEHPDWPETLVEAAAKNQFQEAAEAWMAGTLQLGQVLRPRGLWGYYGFPDCYN-NDFLSLN--YTRQCPVFVRDQNDQLGWLWNQSYALYPSIYLPAALMGTEKS-QMY-VRHRVQEALRVAIVSRDPH-VPVMPYVQ-IFYEMTDYLLPLEELEHSLGESAAQGVAGAVLWLSSDKTSTKESCQAIKAYMDSTLGPFIVNVTSAAL
DSQ  TGCAGAGGTTCC---GTGGTATCCAACCGGCCATTCATCACTGTTTGGAATGGAGACACTCATTGGTGCCTGACGGAGTATGGAGTGGATGTGGATGTCAGTGTC...TTCGATGTGGTTGCCAACAAGGAGCAGAGTTTCCAAGGC---TCTAACATGACAATTTTCTACAGAGAGGAATTGGGCACCTACCCCTACTATACACCCACAGGG------------GAACCCGTATTTGGTGGTCTGCCCCAGAATGCCAGCCTGGTTACCCACCTTGCTCACACATTCCAGGACATCAAGGCTGCCATGCCTGAACCTGACTTCTCAGGACTGGCAGTCATTGATTGGGAGGCTTGGCGCCCACGGTGGGCCTTCAACTGGGACAGCAAGGACATTTATCGGCAGCGCTCAATGGAACTGGTCCAGGCAGAGCACCCTGATTGGCCAGAAACTTTAGTGGAGGCAGCAGCCAAAAACCAGTTCCAGGAAGCTGCAGAGGCCTGGATGGCAGGCACCCTCCAACTGGGGCAGGTACTGCGTCCCCGTGGCCTCTGGGGCTACTATGGCTTCCCTGACTGCTACAAC---AACGACTTTCTAAGTCTCAAC------TACACACGCCAGTGCCCAGTATTCGTCCGTGATCAGAACGACCAGCTAGGGTGGTTATGGAACCAGAGCTATGCCCTTTACCCCAGTATTTATTTGCCTGCAGCACTGATGGGCACAGAGAAGTCA---CAGATGTAC---GTTCGACACCGTGTGCAAGAGGCGCTCCGTGTGGCTATAGTTTCCAGAGACCCCCAT---GTGCCCGTAATGCCCTACGTCCAG---ATCTTCTATGAAATGACAGATTATCTTCTGCCCCTGGAGGAACTGGAGCACAGCCTGGGGGAGAGTGCAGCCCAGGGAGTGGCAGGAGCAGTGCTCTGGCTAAGCTCAGACAAAACAAGTACCAAGGAATCATGCCAGGCCATTAAAGCATACATGGATTCCACACTTGGGCCCTTCATCGTGAACGTGACCAGTGCAGCTCTT
TRN  10010101100011000
NAM  Q12794_HUMAN/22-356
ASQ  FRGP-LLPNRPFTTVWNANTQWCLERHGVDVDVSV.FDVVANPGQTFRG-PDMTIFYSSQLGTYPYYTPTG----EPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYN-YDFLSPN--YTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKS-QMY-VQHRVAEAFRVAVAAGDPN-LPVLPYVQ-IFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGAL
DSQ  TTTAGGGGCCCC---TTGCTACCCAACCGGCCCTTCACCACCGTCTGGAATGCAAACACCCAGTGGTGCCTGGAGAGGCACGGTGTGGACGTGGATGTCAGTGTC...TTCGATGTGGTAGCCAACCCAGGGCAGACCTTCCGCGGC---CCTGACATGACAATTTTCTATAGCTCCCAGCTGGGCACCTACCCCTACTACACGCCCACTGGG------------GAGCCTGTGTTTGGTGGTCTGCCCCAGAATGCCAGCCTGATTGCCCACCTGGCCCGCACATTCCAGGACATCCTGGCTGCCATACCTGCTCCTGACTTCTCAGGGCTGGCAGTCATCGACTGGGAGGCATGGCGCCCACGCTGGGCCTTCAACTGGGACACCAAGGACATTTACCGGCAGCGCTCACGGGCACTGGTACAGGCACAGCACCCTGATTGGCCAGCTCCTCAGGTGGAGGCAGTAGCCCAGGACCAGTTCCAGGGAGCTGCACGGGCCTGGATGGCAGGCACCCTCCAGCTGGGGCGGGCACTGCGTCCTCGCGGCCTCTGGGGCTTCTATGGCTTCCCTGACTGCTACAAC---TATGACTTTCTAAGCCCCAAC------TACACCGGCCAGTGCCCATCAGGCATCCGTGCCCAAAATGACCAGCTAGGGTGGCTGTGGGGCCAGAGCCGTGCCCTCTATCCCAGCATCTACATGCCCGCAGTGCTGGAGGGCACAGGGAAGTCA---CAGATGTAT---GTGCAACACCGTGTGGCCGAGGCATTCCGTGTGGCTGTGGCTGCTGGTGACCCCAAT---CTGCCGGTGCTGCCCTATGTCCAG---ATCTTCTATGACACGACAAACCACTTTCTGCCCCTGGATGAGCTGGAGCACAGCCTGGGGGAGAGTGCGGCCCAGGGGGCAGCTGGAGTGGTGCTCTGGGTGAGCTGGGAAAATACAAGAACCAAGGAATCATGTCAGGCCATCAAGGAGTATATGGACACTACACTGGGGCCCTTCATCCTGAACGTGACCAGTGGGGCCCTT
TRN  10010101100011001
NAM  O43820_HUMAN/21-354
ASQ  QPLP-QVPERPFSVLWNVPSAHCEARFGVHLPLNA.LGIIANRGQHFHG-QNMTIFYKNQLGLYPYFGPRG----TAHNGGIPQALPLDRHLALAAYQIHHSLRP-GFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASN--YTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQ---AFVRHRLEEAFRVALVGHRH-PLPVLAYVR-LTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAM
DSQ  CAGCCCCTACCA---CAGGTCCCTGAACGCCCCTTCTCTGTGCTGTGGAATGTACCCTCAGCACACTGTGAGGCCCGCTTTGGTGTGCACCTGCCACTCAATGCT...CTGGGCATCATAGCCAACCGTGGCCAGCATTTTCACGGT---CAGAACATGACCATTTTCTACAAGAACCAACTCGGCCTCTATCCCTACTTTGGACCCAGGGGC------------ACAGCTCACAATGGGGGCATCCCCCAGGCTTTGCCCCTTGACCGCCACCTGGCACTGGCTGCCTACCAGATCCACCACAGCCTGAGACCT---GGCTTTGCTGGCCCAGCAGTGCTGGATTGGGAGGAGTGGTGTCCACTCTGGGCTGGGAACTGGGGCCGCCGCCGAGCTTATCAGGCAGCCTCTTGGGCTTGGGCACAGCAGGTATTCCCTGACCTGGACCCTCAGGAGCAGCTCTACAAGGCCTATACTGGCTTTGAGCAGGCGGCCCGTGCACTGATGGAGGATACGCTGCGGGTGGCCCAGGCACTACGGCCCCATGGACTCTGGGGCTTCTATCACTACCCAGCCTGTGGCAATGGCTGGCATAGTATGGCTTCCAAC------TATACCGGCCGCTGCCATGCAGCCACCCTTGCCCGCAACACTCAACTGCATTGGCTCTGGGCCGCCTCCAGTGCCCTCTTCCCCAGCATCTACCTCCCACCCAGGCTGCCACCTGCCCACCACCAG---------GCCTTTGTCCGACATCGCCTGGAGGAGGCCTTCCGTGTGGCCCTTGTTGGGCACCGACAT---CCCCTGCCTGTCCTGGCCTATGTCCGC---CTCACACACCGGAGATCTGGGAGGTTCCTGTCCCAGGATGACCTTGTGCAGTCCATTGGTGTGAGTGCAGCACTAGGGGCAGCCGGCGTGGTGCTCTGGGGGGACCTGAGCCTCTCCAGCTCTGAGGAGGAGTGCTGGCATCTCCATGACTACCTGGTGGACACCTTGGGCCCCTATGTGATCAATGTGACCAGGGCAGCGATG
TRN  10010101100011001
NAM  HYAL2_HUMAN/25-363
ASQ  PTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNA.FDVQASPNEGFVN-QNITIFYRDRLGLYPRFDSAG----RSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYN-HDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGR--NFVSFRVQEALRVARTHHANHALPVYVFTR-PTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSWATQ
DSQ  CCCACAGCACCACCCATCTTCACTGGCCGGCCCTTTGTGGTAGCGTGGGACGTGCCCACACAGGACTGTGGCCCACGCCTCAAGGTGCCACTGGACCTGAATGCC...TTTGATGTGCAGGCCTCACCTAATGAGGGTTTTGTGAAC---CAGAATATTACCATCTTCTACCGCGACCGTCTAGGCCTGTATCCACGCTTCGATTCTGCCGGA------------AGGTCTGTGCATGGTGGTGTGCCACAGAATGTCAGCCTTTGGGCACACCGGAAGATGCTGCAGAAACGTGTGGAGCACTACATTCGGACACAGGAGTCTGCGGGGCTGGCGGTCATCGACTGGGAGGACTGGCGACCTGTGTGGGTGCGCAACTGGCAGGACAAAGATGTGTATCGCCGGTTATCACGCCAGCTAGTGGCCAGTCGTCACCCTGACTGGCCTCCAGACCGCATAGTCAAACAGGCACAATATGAGTTTGAGTTCGCAGCACAGCAGTTCATGCTGGAGACACTGCGTTATGTCAAGGCAGTGCGGCCCCGGCACCTCTGGGGCTTCTACCTCTTTCCTGACTGCTACAAT---CATGATTATGTGCAGAACTGGGAGAGCTACACAGGCCGCTGCCCTGATGTTGAGGTGGCCCGCAATGACCAGCTGGCCTGGCTGTGGGCTGAGAGCACGGCCCTCTTCCCGTCTGTCTACCTGGACGAGACACTTGCTTCCTCCCGCCATGGCCGC------AACTTTGTGAGCTTCCGTGTTCAGGAGGCCCTTCGTGTGGCTCGCACCCACCATGCCAACCATGCACTCCCAGTCTACGTCTTCACACGA---CCCACCTACAGCCGCAGGCTCACGGGGCTTAGTGAGATGGACCTCATCTCTACCATTGGCGAGAGTGCGGCCCTGGGCGCAGCTGGTGTCATCCTCTGGGGTGACGCGGGGTACACCACAAGCACGGAGACCTGCCAGTACCTCAAAGATTACCTGACACGGCTGCTGGTCCCCTACGTGGTCAATGTGTCCTGGGCCACCCAA
TRN  10010101100011000
NAM  Q22675_CAEEL/25-360
ASQ  YIGSGASQPNRTDVVWMVPSWTCKN--EYSIDVEK.YGILQNEDQHFVGGKQFAIFYEHSFGKIPYFKAQNES--DPKNGGLPQMGDLEAHLIQAEKDINETIPDENFNGIAVIDIEEFRPMWELSWGPFSVYKTESIRLTRQQHPYWSTKQIEWQAERDYEKACQKFFIETLRLGKRLRPNAKWGYYLFPKCNG--DVGQKS---DTDCSTLFQKFNDNLHWLWGESTALFPSIYLYPSQKQNPEYN-FVNSGALITETKRIKRNYCPSCEIHVFTKIEYNPYYTPDDFYSKQNLASTLDLAIKMNANSVVIWSTSQSIGSR--CGSLQTYVDNTLGPYLQLTDRNLD
DSQ  TACATAGGTTCGGGAGCCTCCCAACCCAACCGAACGGATGTTGTGTGGATGGTTCCCTCTTGGACATGTAAAAAT------GAATATTCAATTGATGTAGAAAAG...TATGGAATTCTGCAAAATGAGGATCAGCATTTTGTTGGTGGAAAACAGTTTGCAATTTTTTATGAGCACAGTTTTGGAAAGATTCCATACTTCAAGGCTCAGAATGAAAGT------GATCCAAAGAACGGAGGGCTACCCCAGATGGGGGATCTCGAAGCTCACTTGATTCAGGCTGAAAAGGATATCAATGAAACTATTCCAGATGAGAATTTCAACGGAATTGCTGTCATTGACATTGAGGAGTTCAGACCTATGTGGGAGCTCAGTTGGGGTCCATTTTCGGTCTACAAAACTGAATCAATTCGTCTCACCCGTCAGCAACATCCCTATTGGTCAACAAAACAAATTGAATGGCAAGCTGAAAGAGATTATGAGAAAGCTTGTCAAAAGTTTTTTATCGAGACTCTTCGACTTGGAAAACGTCTTCGACCAAATGCAAAATGGGGATATTATTTGTTTCCAAAATGCAATGGA------GATGTTGGACAAAAGTCG---------GACACTGATTGTTCTACATTATTTCAAAAGTTTAACGATAATCTACACTGGCTATGGGGAGAAAGTACCGCTCTATTCCCATCAATTTACCTGTATCCTTCTCAAAAGCAAAACCCGGAATATAAT---TTTGTCAATTCAGGAGCTTTAATAACAGAAACAAAACGGATAAAAAGAAACTATTGCCCAAGTTGTGAGATACATGTTTTTACAAAAATTGAATATAATCCATATTATACACCAGATGATTTCTATTCCAAGCAAAATCTTGCCAGCACATTGGATCTTGCCATAAAAATGAACGCGAACAGTGTTGTGATTTGGAGTACATCTCAATCGATCGGAAGTCGT------TGTGGATCACTTCAGACTTATGTAGATAACACATTGGGTCCGTATCTTCAATTAACAGACCGAAATTTGGAC
TRN  10010101100011000
NAM  HUGA_DOLMA/1-331
ASQ  SERP----KRVFNIYWNVPTFMCHQYGLYFDEVTN.FNIKHNSKDDFQG-DKISIFYDP--GEFPALLPLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWGNMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFN-MSPNNLV----PDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVG---LVQGRVKEAVRISNNLKHS--PKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSSDVNSLSKCKRLREYLLTVLGPITVNVTETVN
DSQ  TCCGAGAGACCG------------AAAAGAGTCTTCAACATTTATTGGAACGTTCCTACCTTTATGTGTCATCAGTATGGCCTATACTTCGACGAGGTTACAAAT...TTTAATATAAAGCATAATTCTAAGGACGATTTCCAGGGT---GACAAGATCTCAATTTTTTATGATCCT------GGAGAATTCCCGGCATTGTTGCCGCTCAAAGAAGGCAATTATAAGATAAGAAACGGAGGAGTTCCTCAAGAAGGTAACATAACGATACATCTCCAAAGATTTATCGAAAATTTGGATAAAACATATCCAAATAGGAACTTCAACGGTATCGGTGTGATCGACTTTGAAAGATGGAGACCGATCTTCCGACAAAATTGGGGCAATATGATGATTCATAAGAAGTTTTCAATAGACCTAGTTCGCAATGAACATCCATTCTGGGATAAAAAGATGATCGAATTGGAGGCATCTAAGAGGTTTGAAAAATATGCCAGACTTTTCATGGAGGAAACTTTGAAATTGGCCAAAAAGACTAGGAAGCAGGCCGATTGGGGCTATTACGGATATCCCTACTGTTTTAAT---ATGTCGCCTAATAATCTCGTA------------CCCGATTGTGACGCTACAGCGATGCTCGAGAACGACAAGATGTCGTGGCTGTTCAATAATCAAAATGTACTTCTACCATCCGTCTATATTAGACACGAACTGACCCCTGATCAAAGAGTTGGT---------TTAGTCCAAGGAAGAGTGAAGGAAGCTGTTAGGATATCGAATAATTTAAAACATTCA------CCGAAAGTGCTCTCTTATTGGTGGTACGTGTATCAGGACGATACAAACACTTTTCTTACCGAGACCGACGTGAAAAAGACTTTCCAAGAGATAGCGATTAACGGTGGGGATGGTATCATTATATGGGGTAGCTCGTCCGACGTAAACAGCTTAAGTAAATGTAAGAGATTACGGGAGTATCTGTTGACGGTTTTGGGACCAATCACGGTTAACGTGACGGAAACCGTCAAC
TRN  10010101100011000
NAM  HUGA_APIME/36-368
ASQ  NNKT----VREFNVYWNVPTFMCHKYGLRFEEVSEkYGILQNWMDKFRG-EEIAILYDP--GMFPALLKDPNGNVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYN-LTPNQPS----AQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVG---LVGGRVKEALRIARQMTTSR-KKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKRIALNNN
DSQ  AACAACAAAACC------------GTACGGGAGTTCAACGTTTACTGGAACGTGCCCACCTTTATGTGCCATAAATACGGGCTACGGTTCGAAGAAGTATCGGAGaaaTATGGTATTCTACAGAACTGGATGGATAAGTTTCGGGGC---GAGGAGATCGCGATCCTTTACGACCCT------GGAATGTTCCCGGCGTTGCTGAAAGACCCGAATGGGAACGTGGTGGCGAGGAACGGCGGTGTCCCGCAACTGGGCAATCTCACCAAGCATCTGCAAGTATTTCGGGACCACTTGATCAATCAGATCCCGGACAAGTCGTTTCCCGGCGTGGGGGTGATCGATTTCGAAAGTTGGAGGCCGATATTCAGACAGAACTGGGCCTCCCTCCAGCCTTACAAGAAACTGTCCGTAGAGGTGGTTCGCCGTGAGCATCCGTTCTGGGACGATCAGAGGGTGGAGCAGGAGGCGAAACGAAGGTTCGAGAAATACGGGCAGCTTTTCATGGAGGAGACGTTGAAAGCGGCGAAACGGATGAGGCCGGCCGCCAATTGGGGATACTACGCCTACCCTTATTGCTACAAT---CTGACGCCGAATCAGCCGAGC------------GCCCAATGCGAAGCGACCACCATGCAGGAGAACGATAAAATGTCGTGGCTGTTCGAGTCGGAAGACGTCCTCCTTCCGTCCGTTTACTTGAGATGGAATCTGACGAGCGGCGAAAGAGTGGGC---------CTGGTCGGTGGCCGCGTGAAGGAGGCGTTGAGAATAGCGAGGCAAATGACGACCAGCAGG---AAGAAGGTTCTACCATATTACTGGTACAAATATCAGGATCGAAGGGACACGGATTTGAGCAGGGCTGACCTCGAGGCAACTTTACGAAAAATCACGGACCTCGGCGCCGACGGGTTCATCATTTGGGGAAGTTCCGACGATATAAACACGAAGGCGAAGTGCCTACAATTCAGGGAATACCTGAACAACGAGTTGGGCCCTGCCGTTAAACGAATCGCGTTGAACAACAAC
TRN  10010101100011010
//