EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01613 - Flavin_Reduct)
FAM  PF01613
PID  Flavin_Reduct
DES  Flavin reductase like domain
IPR  IPR002563
ANO  22
ALN  156
AID  0.263585
APH  ((((((O34138_STRVF/25-175:1.03711,(O53254_MYCTU/22-170:0.93222,((O68232_PHOLU/15-164:0.11543,HPAC_KLEOX/14-163:0.27703):0.21489,YCDH_ECOLI/13-160:0.49956):0.57064):0.09479):0.07529,O06835_PSEFL/20-166:0.76350):0.17747,((NTAB_CHEHE/25-169:0.52438,(((O53667_MYCTU/16-159:0.35348,P95275_MYCTU/24-167:0.44062):0.42032,O68503_RHOER/38-186:0.64370):0.21371,(O69360_RHOER/23-166:0.10496,P96849_MYCTU/14-159:0.18276):0.50394):0.19210):0.11161,(SNAC_STRPR/20-167:0.72865,(DIM6_STRCO/12-158:0.38761,O68914_9ACTO/25-171:0.43826):0.23388):0.14462):0.06215):0.26336,O29428_ARCFU/6-158:1.19934):0.07175,(DFA4_SYNY3/445-594:0.64008,(DFA3_SYNY3/449-597:0.27664,(DFA2_SYNY3/429-578:0.24419,DFA1_SYNY3/424-573:0.12773):0.12744):0.15343):0.64334):0.54410,Q07948_SYNP7/11-160:0.16418,Q55660_SYNY3/11-160:0.18793);
ATP  ((((((O34138_STRVF/25-175,(O53254_MYCTU/22-170,((O68232_PHOLU/15-164,HPAC_KLEOX/14-163),YCDH_ECOLI/13-160))),O06835_PSEFL/20-166),((NTAB_CHEHE/25-169,(((O53667_MYCTU/16-159,P95275_MYCTU/24-167),O68503_RHOER/38-186),(O69360_RHOER/23-166,P96849_MYCTU/14-159))),(SNAC_STRPR/20-167,(DIM6_STRCO/12-158,O68914_9ACTO/25-171)))),O29428_ARCFU/6-158),(DFA4_SYNY3/445-594,(DFA3_SYNY3/449-597,(DFA2_SYNY3/429-578,DFA1_SYNY3/424-573)))),Q07948_SYNP7/11-160,Q55660_SYNY3/11-160);
ATL  15.0419
DNO  21
DLN  468
DID  0.417464
DPH  ((((((O69360_RHOER/23-166:0.23991,P96849_MYCTU/14-159:0.10145):0.30901,(SNAC_STRPR/20-167:0.37502,(((O53667_MYCTU/16-159:0.27620,P95275_MYCTU/24-167:0.32554):0.21182,O68503_RHOER/38-186:0.50687):0.08455,(DIM6_STRCO/12-158:0.22746,O68914_9ACTO/25-171:0.34469):0.13601):0.06003):0.07563):0.08375,((O53254_MYCTU/22-170:0.65305,O34138_STRVF/25-175:0.48235):0.09673,O06835_PSEFL/20-166:0.60056):0.07598):0.06182,((Q07948_SYNP7/11-160:0.21888,Q55660_SYNY3/11-160:0.27374):0.19646,(((DFA2_SYNY3/429-578:0.27341,DFA1_SYNY3/424-573:0.17980):0.08852,(DFA3_SYNY3/449-597:0.18651,DFA4_SYNY3/445-594:0.56543):0.06260):0.48538,O29428_ARCFU/6-158:0.63015):0.09372):0.20114):0.06136,NTAB_CHEHE/25-169:0.43595):0.48388,O68232_PHOLU/15-164:0.30423,HPAC_KLEOX/14-163:0.12821);
DTP  ((((((O69360_RHOER/23-166,P96849_MYCTU/14-159),(SNAC_STRPR/20-167,(((O53667_MYCTU/16-159,P95275_MYCTU/24-167),O68503_RHOER/38-186),(DIM6_STRCO/12-158,O68914_9ACTO/25-171)))),((O53254_MYCTU/22-170,O34138_STRVF/25-175),O06835_PSEFL/20-166)),((Q07948_SYNP7/11-160,Q55660_SYNY3/11-160),(((DFA2_SYNY3/429-578,DFA1_SYNY3/424-573),(DFA3_SYNY3/449-597,DFA4_SYNY3/445-594)),O29428_ARCFU/6-158))),NTAB_CHEHE/25-169),O68232_PHOLU/15-164,HPAC_KLEOX/14-163);
DTL  10.1984
RID  0.264798
RPH  (((O34138_STRVF/25-175:1.05841,(O06835_PSEFL/20-166:0.74474,((((DFA4_SYNY3/445-594:0.63975,(DFA3_SYNY3/449-597:0.27742,(DFA2_SYNY3/429-578:0.24405,DFA1_SYNY3/424-573:0.12773):0.12657):0.15369):0.63909,(Q07948_SYNP7/11-160:0.16711,Q55660_SYNY3/11-160:0.18493):0.54823):0.06969,O29428_ARCFU/6-158:1.20943):0.26101,((NTAB_CHEHE/25-169:0.52496,(((O53667_MYCTU/16-159:0.35349,P95275_MYCTU/24-167:0.44127):0.42200,O68503_RHOER/38-186:0.64201):0.21576,(O69360_RHOER/23-166:0.10146,P96849_MYCTU/14-159:0.18636):0.50276):0.18910):0.10315,(SNAC_STRPR/20-167:0.72905,(DIM6_STRCO/12-158:0.39162,O68914_9ACTO/25-171:0.43428):0.23416):0.14672):0.06582):0.18805):0.04092):0.16908,O53254_MYCTU/22-170:0.88861):0.73718,O68232_PHOLU/15-164:0.13268,HPAC_KLEOX/14-163:0.26082);
RTP  (((O34138_STRVF/25-175,(O06835_PSEFL/20-166,((((DFA4_SYNY3/445-594,(DFA3_SYNY3/449-597,(DFA2_SYNY3/429-578,DFA1_SYNY3/424-573))),(Q07948_SYNP7/11-160,Q55660_SYNY3/11-160)),O29428_ARCFU/6-158),((NTAB_CHEHE/25-169,(((O53667_MYCTU/16-159,P95275_MYCTU/24-167),O68503_RHOER/38-186),(O69360_RHOER/23-166,P96849_MYCTU/14-159))),(SNAC_STRPR/20-167,(DIM6_STRCO/12-158,O68914_9ACTO/25-171)))))),O53254_MYCTU/22-170),O68232_PHOLU/15-164,HPAC_KLEOX/14-163);
RTL  14.5054
LNK  DFA1_SYNY3/424-573:Q55393:D64003
LNK  DFA2_SYNY3/429-578:P72723:D90900
LNK  DFA3_SYNY3/449-597:P74373:D90914
LNK  DFA4_SYNY3/445-594:P72721:D90900
LNK  DIM6_STRCO/12-158:Q02058:X63449
LNK  HPAC_KLEOX/14-163:Q48441:L41068
LNK  NTAB_CHEHE/25-169:P54990:U39411
LNK  O06835_PSEFL/20-166:O06835:Z92524
LNK  O29428_ARCFU/6-158:O29428:AE001047
LNK  O34138_STRVF/25-175:O34138:U93606
LNK  O53254_MYCTU/22-170:O53254:BX842581
LNK  O53667_MYCTU/16-159:O53667:BX842572
LNK  O68232_PHOLU/15-164:O68232:AF021839
LNK  O68503_RHOER/38-186:O68503:AF048979
LNK  O68914_9ACTO/25-171:O68914:AF058302
LNK  O69360_RHOER/23-166:O69360:D88018
LNK  P95275_MYCTU/24-167:P95275:BX842578
LNK  P96849_MYCTU/14-159:P96849:BX842583
LNK  Q07948_SYNP7/11-160:Q07948:L19521
LNK  Q55660_SYNY3/11-160:Q55660:BA000022
LNK  SNAC_STRPR/20-167:P54994:U21216
LNK  YCDH_ECOLI/13-160:P75893:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q55660_SYNY3/11-160
ASQ  LRKIPHGLYVCGVKS-GEEANGFTASWVMQGSFEPPLVVNCVRTDSISHRLLQESGQFALSFLAAD-QKDVAAQFFKPQRR-.VGDKFENFDVLDAPETGCPVLKDCLGYVECRVVGSVAHGDHTVFVGEVIGAQVFNE--GDPLLLESTGWNYGG
DSQ  CTGCGTAAAATTCCCCACGGCCTCTACGTCTGTGGTGTTAAGTCC---GGAGAAGAAGCCAATGGTTTCACCGCCAGTTGGGTAATGCAGGGTTCCTTTGAGCCGCCCCTGGTGGTTAATTGCGTGCGCACTGATTCCATTTCCCATCGGCTGTTACAGGAAAGTGGCCAGTTTGCCCTCAGTTTTCTGGCGGCGGAC---CAAAAAGATGTGGCGGCGCAATTTTTTAAACCCCAACGGCGG---...GTGGGGGACAAGTTTGAAAATTTTGATGTGCTTGATGCCCCCGAAACCGGTTGTCCTGTGCTCAAAGACTGTCTCGGTTATGTGGAGTGTCGGGTGGTAGGGTCTGTGGCCCACGGCGATCACACCGTTTTTGTCGGCGAAGTCATTGGAGCCCAGGTTTTTAATGAA------GGAGATCCCTTATTACTAGAAAGCACTGGCTGGAACTACGGCGGT
TRN  11011101101011010
NAM  Q07948_SYNP7/11-160
ASQ  LRKIPHGLYVCGVKD-GEEINGFTASWVMQGSFQPPLVINCVKSDSRSHAMLSASGVFSLSFLEAG-QKDLAAQFFKPQRL-.VANKFETVNAYLGEATGCPILEEALGYVECRVVGKVEHGDHTVFVGEVIAAGLHSE--GDLLTLESTGWNYGG
DSQ  CTGCGCAAAATTCCGCATGGTCTTTACGTTTGCGGCGTCAAGGAT---GGCGAGGAGATCAACGGCTTTACTGCCAGCTGGGTGATGCAGGGCTCGTTCCAGCCGCCCTTAGTGATCAACTGTGTCAAATCCGACTCGCGCTCCCATGCCATGCTCTCGGCAAGCGGCGTCTTCAGCTTGAGCTTCTTGGAAGCAGGC---CAGAAGGATCTGGCCGCTCAATTCTTTAAGCCGCAGCGCTTG---...GTTGCCAATAAATTTGAAACGGTCAACGCCTACCTCGGCGAAGCCACCGGTTGCCCAATTTTGGAAGAGGCCCTGGGCTACGTCGAATGCCGTGTAGTCGGCAAGGTTGAGCACGGGGATCACACGGTTTTCGTCGGTGAAGTGATTGCTGCAGGCTTACACAGCGAG------GGGGACCTGCTGACGCTGGAAAGCACCGGCTGGAACTACGGCGGC
TRN  11011101101011010
NAM  O68503_RHOER/38-186
ASQ  LRRHPAGVTVVTLDS-GTGPVGFTATSFSSVSLEPPLVSFNIAETSSSINALKAAESLVIHLLGEH-QQHLAQRFARSA---.-DQRFADESLWAVLDTGEPVLHGTPSWMRVKVDQLIPVGDHTLVIGLVTRVHAEEDDESAAAPLLYHEGKYYR
DSQ  CTTCGCCGCCACCCCGCCGGTGTCACCGTCGTGACCCTCGATTCG---GGTACCGGCCCGGTGGGTTTCACCGCCACCTCGTTCTCGTCCGTCTCCCTCGAGCCGCCGCTCGTCTCGTTCAACATCGCGGAGACGTCGTCGAGCATCAATGCACTCAAGGCAGCCGAGTCCTTGGTGATCCACCTTCTCGGCGAACAT---CAGCAGCATCTGGCCCAGCGCTTTGCGCGTAGTGCC---------...---GATCAGCGTTTTGCAGACGAGTCACTGTGGGCAGTGCTCGACACCGGGGAACCGGTGCTGCACGGCACCCCCAGCTGGATGCGCGTCAAGGTCGACCAGCTGATCCCTGTCGGCGACCACACGCTGGTCATCGGACTCGTCACGCGGGTTCACGCCGAAGAAGACGACGAATCCGCTGCCGCGCCGCTGCTCTACCACGAGGGCAAGTACTACCGC
TRN  11011111101111101
NAM  O68914_9ACTO/25-171
ASQ  MSCFPAGVVLVTTREEDGTPRGFTASSFCSVSLAPPLVSVCQGTGAQSYGAFQECARFAVSVLRSG-QRELASRFATRG---.-ADKFGGGGLVALEGSGLLVAADALVTLECAVHARHLAGDHVILVGEVRGVGQGE---GEPLVHWERGFRALR
DSQ  ATGTCGTGCTTCCCCGCGGGGGTGGTCCTCGTGACGACGCGCGAGGAGGACGGCACCCCCCGCGGTTTCACGGCGAGTTCCTTCTGCTCGGTGTCGCTCGCTCCCCCGCTGGTGTCGGTGTGCCAGGGCACGGGCGCGCAGTCCTACGGGGCGTTCCAGGAGTGCGCGCGGTTCGCGGTGAGCGTGCTGCGGAGCGGA---CAGCGGGAGCTGGCCTCGCGGTTCGCGACGCGCGGG---------...---GCGGACAAGTTCGGGGGCGGGGGGCTCGTGGCGCTGGAGGGCTCGGGGCTGCTGGTCGCGGCGGACGCGCTCGTCACGCTGGAGTGCGCGGTACACGCCCGGCACCTGGCCGGGGACCACGTGATCCTCGTCGGCGAGGTGCGCGGGGTGGGGCAGGGTGAG---------GGCGAACCGCTCGTGCACTGGGAGCGGGGGTTTCGCGCGCTGCGC
TRN  11011111101111111
NAM  DIM6_STRCO/12-158
ASQ  MARVPAGVALVTAHDRGGVPHGFTASSFVSVSMEPPLALVCLARTANSFPVFDSCGEFAVSVLRED-HTDLAMRFARKS---.-ADKFAGGEFVRT-ARGATVLDGAVAVVECTVHERYPAGDHIILLGEVQSVHVEEK--GVPAVYVDRRFAALC
DSQ  ATGGCCCGGGTGCCGGCCGGGGTGGCGCTCGTCACCGCCCATGACCGCGGGGGAGTCCCGCACGGTTTCACCGCCAGTTCGTTCGTGTCCGTCTCGATGGAGCCGCCACTGGCACTGGTCTGCCTGGCTCGTACGGCCAACTCCTTCCCGGTGTTCGACAGTTGCGGCGAGTTCGCGGTGAGCGTGCTGCGCGAGGAC---CACACGGACCTGGCCATGCGCTTCGCGCGCAAGTCC---------...---GCGGACAAGTTCGCGGGCGGGGAGTTCGTCCGTACC---GCGCGGGGAGCGACCGTGCTCGACGGAGCGGTCGCGGTCGTCGAGTGCACGGTCCACGAGCGCTACCCGGCGGGCGACCACATCATCCTGCTCGGCGAGGTCCAGTCCGTGCACGTCGAGGAGAAG------GGCGTACCGGCGGTCTACGTGGACCGCCGGTTCGCCGCCCTGTGC
TRN  11011111101111111
NAM  SNAC_STRPR/20-167
ASQ  MAQLASPVTVVTVLDAAGRRHGFTAGSVVSVSLDPPLVMVGIALTSSCHTAMAAAAEFCVSILGED-QRAVAKRCATHG---.-ADRFAGGEFAAWDGTGVPYLPDAKVVLRCRTTDVVRAGDHDLVLGTPVEIRTGDP--AKPPLLWYRRDFHTP
DSQ  ATGGCGCAGCTGGCGTCGCCCGTCACCGTCGTAACCGTCCTCGACGCGGCCGGACGCCGCCACGGCTTCACGGCCGGCTCGGTGGTCTCTGTGTCGCTGGACCCGCCGCTGGTGATGGTCGGCATCGCGCTCACCTCCAGCTGCCACACGGCGATGGCCGCCGCCGCCGAGTTCTGCGTCAGCATCCTCGGCGAGGAC---CAGCGCGCCGTCGCGAAGCGGTGCGCGACGCACGGC---------...---GCCGACCGGTTCGCGGGCGGCGAGTTCGCCGCCTGGGACGGTACGGGGGTGCCCTACCTGCCGGACGCCAAGGTCGTCCTGCGCTGCCGCACCACGGACGTGGTGCGCGCCGGCGACCACGACCTGGTGCTCGGCACGCCCGTGGAGATCCGCACGGGCGACCCG------GCGAAGCCACCCCTGCTGTGGTACCGCCGCGACTTCCACACCCCG
TRN  11011111101111111
NAM  P96849_MYCTU/14-159
ASQ  LGQFCTGITVITTVH-DDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEK-QKDVSARFGSKE---.-PDKFAGIDWRPS-ELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPA--VKPRPLLFYRGDYTG
DSQ  CTCGGTCAGTTCTGTACGGGGATCACTGTCATCACCACTGTGCAC---GACGACGTGCCCGTCGGGTTTGCGTGCCAGTCGTTCGCGGCGCTGTCGTTGGAACCGCCGTTGGTGCTGTTCTGCCCCACTAAGGTGTCGCGGTCCTGGCAGGCCATCGAGGCCAGCGGCCGGTTCTGCGTCAACGTACTGACCGAAAAG---CAGAAAGACGTCTCGGCGCGATTCGGCTCGAAGGAG---------...---CCGGACAAGTTCGCCGGTATCGATTGGCGCCCTTCG---GAACTAGGCTCACCGATCATCGAGGGATCGCTGGCCTACATTGACTGCACGGTGGCGTCGGTGCACGACGGCGGCGATCACTTCGTGGTGTTCGGTGCCGTCGAGTCACTGTCAGAGGTCCCGGCG------GTCAAGCCGCGGCCGCTGCTGTTCTATCGCGGCGACTACACCGGC
TRN  11011101101011001
NAM  O69360_RHOER/23-166
ASQ  LGQFCTGITIITTVD-DGEPVGFACQSFAALSLDPPLVLFCPTKGSRSWAAIERTGKFAVNVLAEE-QQAVCARFGSRE---.-PDKFAGIDWTPS-PLGSPIIDKSLAHIDCTVETVHDGGDHYVVFGRVSSMSEIKT--ER--PLLFYRGQYTG
DSQ  CTCGGGCAATTCTGCACGGGTATCACCATCATCACGACAGTCGAC---GACGGTGAGCCTGTCGGGTTCGCATGTCAGTCTTTCGCGGCCCTGTCACTCGACCCGCCTTTGGTGTTGTTCTGCCCCACCAAGGGTTCTCGGTCGTGGGCGGCAATCGAGCGGACCGGTAAGTTCGCCGTCAACGTGTTGGCGGAGGAA---CAGCAGGCGGTGTGTGCTCGTTTCGGGTCACGTGAG---------...---CCGGACAAGTTCGCCGGCATCGATTGGACGCCATCG---CCTCTGGGCTCGCCAATCATCGACAAGTCCCTTGCACACATCGACTGCACGGTGGAAACCGTCCACGACGGCGGCGATCACTACGTCGTCTTCGGTCGGGTTTCGTCGATGAGTGAGATCAAGACC------GAACGC------CCGCTGCTCTTCTATCGCGGGCAGTACACGGGC
TRN  11011111101111101
NAM  NTAB_CHEHE/25-169
ASQ  LGTFPTGVTIVTAPG-VDGPAGVTANSFASVSLDPPLVLWSIGHTSRSHSKFQQSATFAINILADD-QVGVSQVFAGGS---.-ADKFSLVDWHTG-RTGAPLIDNALAYFDCVCEARHEGGDHTIMIGRVVDFGRAE---GSPLAFSQGRYGVTL
DSQ  CTCGGAACTTTTCCGACCGGCGTTACTATAGTTACCGCTCCCGGG---GTGGACGGTCCCGCAGGCGTTACAGCCAATTCCTTCGCTTCGGTGTCGCTCGATCCGCCGCTGGTACTCTGGTCGATCGGACACACCTCGCGTAGCCATTCGAAATTTCAGCAAAGCGCGACTTTCGCCATAAATATTCTTGCTGACGAC---CAGGTCGGCGTCTCGCAGGTATTCGCTGGCGGAAGT---------...---GCCGACAAGTTCAGTTTGGTGGACTGGCACACAGGC---AGAACGGGAGCGCCGCTGATTGACAACGCTCTGGCCTATTTCGACTGCGTCTGCGAGGCTAGGCACGAAGGAGGCGATCATACCATCATGATAGGCCGCGTCGTCGACTTCGGGCGCGCCGAG---------GGAAGCCCGCTGGCTTTTTCACAGGGTCGCTATGGAGTTACATTA
TRN  10010101100011000
NAM  P95275_MYCTU/24-167
ASQ  FGCFPCGVIAVCAMV-DDQPVGMAASSFTSVSVDPPLVSICVQNCSTTWPKLRDRPRLGVSVLAEG-HDAACMSLSRKE---.-GNRFAGVFWSEL-SSGGVVIAGAGAWLDCRPYAEIPAGDHLIALLEICAVRADPE--TP--PLVFHGSRFRR
DSQ  TTCGGCTGCTTTCCGTGCGGCGTGATCGCCGTCTGCGCGATGGTC---GACGACCAGCCGGTCGGCATGGCGGCCAGCTCGTTCACGTCGGTTTCAGTTGACCCGCCGCTGGTATCGATCTGTGTGCAGAACTGTTCGACGACGTGGCCGAAGTTGCGCGACCGCCCACGGCTCGGTGTGAGCGTGCTCGCCGAGGGG---CACGACGCGGCCTGTATGAGCCTGTCGCGCAAGGAA---------...---GGTAACCGGTTCGCCGGGGTGTTCTGGAGCGAATTG---TCCAGCGGGGGTGTGGTGATCGCCGGGGCCGGCGCCTGGCTGGATTGCCGCCCGTACGCGGAGATCCCGGCGGGGGATCACCTGATCGCCCTGCTGGAGATCTGCGCGGTGCGCGCCGATCCCGAG------ACACCG------CCGCTGGTGTTTCACGGTAGCCGGTTCCGCCGG
TRN  11011111101111101
NAM  O53667_MYCTU/16-159
ASQ  FGHFPTGVVAIAAEV-DGVRQGLAASTFVPVSLEPPLVSFCVQNTSTTWPKLTGVPMLGISVLGEA-HDAAVRTLAAKT---.-GDRFAGLETVSN-DAGAVFIKGTSVWLESAIEQLVPAGDHTIVVLRVNQVKVDPN--VA--PIVFHRSVLRR
DSQ  TTCGGCCATTTCCCGACCGGGGTGGTGGCCATCGCTGCGGAGGTC---GACGGAGTGCGGCAAGGCTTGGCAGCCAGTACCTTTGTCCCGGTCTCGCTGGAACCGCCGCTGGTGTCGTTCTGTGTGCAGAACACCTCGACGACATGGCCGAAACTCACCGGCGTGCCGATGCTGGGCATCAGCGTGCTCGGCGAGGCC---CATGACGCCGCAGTGCGCACACTGGCCGCAAAAACT---------...---GGGGACAGGTTCGCCGGTTTGGAGACGGTATCCAAC---GACGCCGGCGCCGTCTTCATCAAGGGCACCAGCGTGTGGCTCGAGAGCGCGATCGAGCAGCTGGTCCCGGCGGGAGATCACACCATCGTGGTCTTACGGGTCAACCAGGTCAAGGTGGATCCCAAC------GTAGCG------CCCATTGTGTTCCATCGCAGCGTGCTCCGCCGA
TRN  10010101100011010
NAM  O06835_PSEFL/20-166
ASQ  VALFATGIAVLSAETEEGEVHGMTVNSFTSISLDPPTVMVSLK-SGRMHELLTRGGRFGVSLLGES-QKVFSAFFSKRV---.-MDDTPSPAFTIQ--AGLPTLRDAMAWFECEVESTVQVHDHTLFIARVSACGTPEANAPQPLLFFASRYHGKP
DSQ  GTTGCACTGTTCGCGACGGGAATTGCGGTTCTCAGTGCGGAGACTGAAGAGGGTGAAGTGCATGGCATGACCGTGAACAGCTTCACCTCCATCAGCCTGGATCCGCCGACTGTGATGGTTTCCCTGAAA---TCGGGCCGTATGCATGAGCTGCTGACTCGAGGCGGACGCTTCGGCGTCAGTCTCCTGGGCGAAAGC---CAGAAGGTGTTCTCGGCATTCTTCAGCAAGCGCGTG---------...---ATGGATGACACGCCTTCCCCCGCCTTCACCATTCAG------GCTGGCCTTCCCACTCTGCGGGACGCCATGGCCTGGTTTGAATGCGAAGTGGAGAGCACGGTTCAAGTACATGACCACACGCTTTTCATCGCACGTGTTAGCGCCTGTGGAACGCCTGAGGCGAATGCGCCCCAGCCGCTGCTGTTTTTTGCCAGTCGTTATCACGGCAAGCCG
TRN  11011101101011011
NAM  YCDH_ECOLI/13-160
ASQ  MSCMGAAVNIITTDG-PAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPAFNENRTLCVNTLSAG-QEPLSNLFGGKTP--.MEHRFAAARWQTG-VTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHTT--PYGLVWFDRSYHALM
NAM  HPAC_KLEOX/14-163
ASQ  MASLSPAVNVITTEA-EAGAAVSPHRPSCSVTDTPPSVMVCINANSAMNPVFQGNGKLCINVLNHE-QEEMARHFAGMTGMT.MDDRFGLSGWQKG-ALGQPVLKGALASLEGEISQVQTIGSHLVYLVEIRNITLSQQ--GHGLIYFKRRFHPVM
DSQ  ATGGCCAGTCTGTCGCCAGCCGTTAACGTCATCACCACCGAAGCC---GAGGCGGGCGCTGCGGTATCACCCCACCGGCCGTCCTGTTCGGTGACCGATACGCCGCCGTCGGTGATGGTCTGCATCAACGCCAATAGCGCGATGAATCCGGTGTTTCAGGGCAACGGCAAGCTGTGCATCAACGTGCTGAACCACGAG---CAAGAGGAGATGGCCCGCCACTTCGCCGGCATGACCGGGATGACG...ATGGACGACCGCTTCGGCCTCAGCGGCTGGCAAAAAGGC---GCGCTGGGCCAGCCGGTGCTGAAAGGCGCGCTGGCGAGCCTCGAAGGCGAAATTAGCCAGGTGCAGACCATCGGTAGCCATCTGGTCTATCTGGTGGAAATCAGGAATATTACCCTGAGCCAGCAA------GGTCACGGGCTGATTTACTTTAAGCGCCGCTTCCATCCGGTGATG
TRN  10010101100011001
NAM  O68232_PHOLU/15-164
ASQ  MASLSAAVNIVTTDG-HADAGGITATAVCSITDTPPTLMVCINRSSAMNPVFQENGRLCVNILNHE-QELMARHFAGMTRVS.MEERFSLSIWQTG-PLGQPVLYGTLASLEGEIEQVQSGGTHNVYLVQIKHITVSEQ--GHGLIYFKRNFRPVM
DSQ  ATGGCGAGTCTGTCAGCAGCGGTGAATATCGTCACCACCGATGGC---CATGCGGATGCTGGTGGCATCACTGCCACCGCGGTATGCTCAATCACCGATACGCCACCCACGCTGATGGTATGCATTAACCGAAGCAGTGCTATGAATCCAGTTTTTCAGGAAAATGGCCGCCTGTGCGTAAATATTTTAAACCACGAA---CAAGAACTGATGGCACGCCACTTTGCCGGTATGACCCGGGTCAGC...ATGGAAGAGCGTTTTTCGCTGAGTATCTGGCAGACAGGC---CCATTAGGCCAACCAGTGTTATACGGTACCCTTGCAAGCCTTGAAGGTGAAATCGAACAGGTTCAAAGTGGAGGCACGCATAACGTGTATCTGGTTCAGATTAAACATATCACGGTAAGCGAACAA------GGCCACGGCCTCATCTATTTCAAGCGTAATTTCCGTCCAGTCATG
TRN  11011101101011000
NAM  O34138_STRVF/25-175
ASQ  TRQLPTGVAVVTAQD-GEVAHGATVSTVSVLSQQPLRIGVSLRRGSYLTGLIRQRRVFALNVLSSR-QSAVADWFANPERPR.GWRQFDYVRWTAHPKAGMPVLEDALAQLHCRLTDLIPLGASDDLLVAEVLDGRGRN--GRPLVNFNGRLHDVE
DSQ  ACCCGCCAGCTGCCCACGGGCGTCGCGGTGGTGACGGCCCAGGAC---GGCGAGGTGGCACACGGGGCGACTGTCAGCACCGTCAGCGTACTGTCGCAACAGCCGCTGCGCATCGGTGTCAGCCTGCGACGCGGTTCGTATCTGACAGGGCTGATCCGCCAAAGGCGCGTGTTCGCCCTCAACGTTCTGTCCTCCCGA---CAGTCGGCTGTGGCTGACTGGTTTGCCAACCCGGAACGGCCGCGG...GGGTGGCGCCAGTTCGATTACGTCCGGTGGACAGCGCATCCGAAAGCCGGGATGCCCGTCCTGGAGGACGCTCTCGCCCAGCTTCACTGCCGGCTAACGGACCTGATCCCCCTAGGAGCCAGCGACGATCTGCTGGTCGCCGAGGTTCTCGACGGCCGGGGACGGAAC------GGCAGGCCACTGGTCAACTTCAACGGCCGGCTACATGACGTCGAG
TRN  10010101100011011
NAM  O53254_MYCTU/22-170
ASQ  MGMLDHPVFVVTTQA-DGHPAGCLVSFATQTSVQPPSFMVGLPRSTGTSEVASRSEHLAVHVLSQR-QHVLAELFGSQTEEE.-VNKFARCSWRAG-PCGMPILDDAAAWFIGRTASRSDVGDYVAYLLEPVSVWAPEC--SEDLLYLSDLDFDVD
DSQ  ATGGGGATGCTGGACCACCCGGTGTTTGTGGTGACAACCCAGGCC---GATGGTCACCCCGCGGGTTGTCTGGTCAGCTTCGCTACCCAAACGAGCGTGCAGCCCCCGAGTTTTATGGTCGGCCTGCCGAGGAGCACCGGCACCTCCGAGGTGGCGAGCCGATCCGAGCACCTCGCCGTGCACGTGCTTTCGCAGCGG---CAGCATGTGCTCGCCGAACTGTTCGGCAGCCAAACGGAGGAGGAG...---GTCAACAAGTTCGCCCGTTGCTCGTGGCGCGCTGGC---CCCTGTGGAATGCCGATTCTCGACGACGCGGCCGCCTGGTTCATCGGTAGGACGGCCAGTCGCAGCGATGTCGGGGATTATGTGGCTTACCTGTTGGAGCCCGTGAGCGTGTGGGCTCCGGAGTGC------TCGGAAGATCTGCTCTACCTCTCCGACCTCGACTTTGATGTCGAC
TRN  10010101100011011
NAM  DFA1_SYNY3/424-573
ASQ  IGRISGGLYIITAQK-GEVKGAMLASWVSQASFNPPGFTVAVAKDRAIESLMQVGDRFVLNILEEGNYQILMKHFLKRFPPG.-ADRFAGVKTQTA-SNGSPILTDALAYLECEVASRMECSDHWIVYSQVTNGRVAKA--EGLTAVHHRKVGNYY
DSQ  ATCGGTCGCATTAGTGGGGGGCTGTATATCATCACTGCCCAAAAG---GGAGAGGTTAAAGGGGCCATGCTTGCCTCTTGGGTTTCCCAAGCCAGCTTTAATCCCCCTGGTTTCACCGTTGCTGTGGCCAAGGACCGGGCCATTGAATCCCTCATGCAAGTCGGTGATCGCTTTGTGTTGAACATTTTGGAGGAAGGCAACTATCAAATTTTGATGAAACATTTCCTCAAACGTTTCCCCCCTGGT...---GCTGATCGTTTTGCTGGAGTAAAAACCCAAACCGCA---AGCAACGGATCGCCTATTTTGACCGATGCGCTAGCCTATTTGGAGTGTGAAGTAGCTAGTCGGATGGAATGTAGTGATCACTGGATTGTTTACAGCCAAGTAACCAATGGTCGGGTAGCTAAAGCA------GAAGGGTTAACCGCCGTACACCATCGCAAAGTCGGCAATTATTAC
TRN  11011101101011010
NAM  DFA2_SYNY3/429-578
ASQ  IGRLSTGLYILTAQK-GDVRSAMLASWVIQGSFEPLGIVIAVAKDRAIESLLHPGDTFVLNVLEEDNYQSLMRHFLLRFPPG.-ADRFAGVNTYPA-QNGSPILLETLAYLECEVTSRLDGNDHWLVYSTIQTGRVAKL--NALTATHHRKLGNHY
DSQ  ATCGGTCGCCTCAGCACTGGACTGTATATTTTAACCGCTCAAAAG---GGAGATGTGCGGAGTGCCATGTTAGCTTCCTGGGTGATTCAAGGCAGCTTTGAACCCCTGGGCATTGTCATTGCAGTGGCCAAAGACCGGGCGATCGAATCATTACTCCATCCCGGCGATACTTTCGTGCTCAATGTGCTGGAAGAGGACAACTATCAAAGCCTCATGCGCCATTTCCTCCTCCGTTTTCCCCCAGGG...---GCAGACCGCTTTGCCGGAGTTAACACCTATCCTGCC---CAGAACGGTTCTCCGATCCTGTTGGAAACCCTAGCTTATCTGGAATGTGAGGTTACCTCCCGTCTTGATGGCAATGACCATTGGTTGGTCTACAGCACCATACAAACTGGACGAGTCGCCAAATTG------AATGCCCTAACCGCCACTCACCACCGCAAACTGGGCAACCACTAC
TRN  10010101100011000
NAM  DFA3_SYNY3/449-597
ASQ  LGRLVGSLCVVTAQQ-GELSSAMLASWVSQATFSPPGLTVAVAKERAIESLLHKNSCFVLNILQEGNHLGLMKHFLKPFAPG.-GDRFADVATETA-ENGAPILTESLAYLECRVQQRLECGDHWVLYAVTDRGALLK---DGVTAVHHRKSGDHY
DSQ  TTAGGCCGTTTAGTGGGTTCCCTCTGTGTGGTTACCGCCCAGCAA---GGGGAATTGAGCAGTGCCATGTTAGCTTCCTGGGTTTCCCAAGCTACCTTTTCCCCCCCTGGTTTGACCGTTGCCGTTGCCAAAGAAAGGGCGATCGAATCTTTGCTACACAAAAACAGTTGCTTTGTGTTGAATATTTTGCAGGAAGGCAACCATCTGGGACTGATGAAACATTTTCTCAAACCCTTTGCCCCCGGC...---GGCGATCGGTTTGCAGACGTGGCCACGGAAACGGCG---GAAAATGGCGCACCAATTTTGACGGAATCCCTGGCTTATTTGGAATGTCGGGTACAACAACGGCTGGAGTGCGGTGACCATTGGGTTCTTTACGCCGTGACTGACCGGGGTGCCCTACTCAAA---------GATGGGGTAACGGCGGTGCATCACCGGAAATCTGGCGATCATTAT
TRN  10010101100011010
NAM  DFA4_SYNY3/445-594
ASQ  VGRIIGSIGVVTTQT-TGRHQGILTSWVSQASFTPPGIMLAIPGEFDAYGLAGQNKAFVLNLLQEG--RSVRRHFDHQPLPKdGDNPFSRLEHYST-QNGCLILAEALAYLECLVQSWSNIGDHVLVYATVQAGQVLQP--NGITAIRHRKSGGQY
DSQ  GTGGGACGTATTATCGGCTCCATTGGTGTGGTTACAACCCAAACA---ACTGGCCGCCATCAAGGGATTTTGACCTCCTGGGTTTCCCAAGCCAGCTTCACTCCCCCTGGCATTATGCTCGCAATTCCGGGCGAATTTGATGCCTACGGTTTGGCCGGACAAAATAAGGCTTTTGTGCTCAATCTTCTGCAGGAAGGT------AGGAGTGTACGGCGTCATTTTGATCACCAGCCCCTGCCGAAAgatGGGGATAATCCCTTCAGCAGATTGGAACATTATTCAACC---CAGAATGGCTGTCTGATTCTAGCGGAGGCGCTGGCTTATCTTGAATGCCTCGTCCAATCTTGGTCGAATATAGGCGATCATGTCCTGGTTTATGCAACAGTTCAGGCCGGACAAGTGTTACAACCC------AACGGCATCACTGCCATACGACACCGCAAATCGGGGGGACAATAT
TRN  10010101100011000
NAM  O29428_ARCFU/6-158
ASQ  FYKISYGLYIVTSES-NGRKCGQIANTVFQLTSKPVQIAVCLNKENDTHNAVKESGAFGVSVLELETPMEFIGRFGFRKSSE.-FEKFDGVEYKTGKTGVPLVTQHAVAVIEAKVVKECDVGTHTLFVGEAVDAEVLKDAEVLTYADYHLMKKGKT
DSQ  TTTTACAAAATCAGTTACGGACTCTACATTGTCACCTCTGAAAGC---AACGGCAGGAAATGCGGGCAGATAGCCAACACGGTCTTTCAGCTCACTAGCAAGCCCGTGCAGATTGCCGTTTGCCTGAACAAGGAGAACGACACCCACAATGCCGTAAAGGAGAGCGGGGCTTTTGGTGTCAGCGTTCTTGAGCTCGAAACACCGATGGAGTTCATAGGAAGATTTGGGTTCAGGAAGAGCAGCGAG...---TTTGAGAAGTTTGATGGGGTTGAGTACAAAACGGGCAAGACTGGAGTGCCTCTCGTAACCCAGCACGCTGTGGCGGTGATAGAGGCAAAGGTTGTTAAGGAGTGCGACGTCGGCACCCACACGCTGTTCGTTGGGGAGGCTGTTGATGCTGAGGTATTGAAGGATGCAGAGGTGCTTACCTACGCTGACTACCATCTCATGAAGAAGGGTAAGACG
TRN  10010101100011011
//