EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01606 - Arteri_env)
FAM  PF01606
PID  Arteri_env
DES  Arterivirus envelope protein
IPR  IPR002556
ANO  3
ALN  213
AID  0.4375
APH  (YOR3_PRRSL/1-211:0.22944,O55481_PRRSV/1-212:0.28476,Q06499_LDV/1-191:1.16077);
ATP  (YOR3_PRRSL/1-211,O55481_PRRSV/1-212,Q06499_LDV/1-191);
ATL  1.67497
DNO  3
DLN  639
DID  0.544092
DPH  (YOR3_PRRSL/1-211:0.26035,O55481_PRRSV/1-212:0.19551,Q06499_LDV/1-191:0.70063);
DTP  (YOR3_PRRSL/1-211,O55481_PRRSV/1-212,Q06499_LDV/1-191);
DTL  1.15649
RID  0.4375
RPH  (YOR3_PRRSL/1-211:0.22944,O55481_PRRSV/1-212:0.28476,Q06499_LDV/1-191:1.16077);
RTP  (YOR3_PRRSL/1-211,O55481_PRRSV/1-212,Q06499_LDV/1-191);
RTL  1.67497
LNK  O55481_PRRSV/1-212:O55481:AJ223079
LNK  Q06499_LDV/1-191:Q06499:L13298
LNK  YOR3_PRRSL/1-211:Q04567:M96262
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YOR3_PRRSL/1-211
ASQ  MAHQCARFHFFLCGFICYLVHSALASNSSSTLCFWFPLAH-GNTSFELTINYTICMPCSTSQAARQRLEPGRNMWCKIGHDRCEERDHDELLMSIPSGYDN-LKLEGYYAWLAFLSFSYAAQFHPELFGIGNVSRVFVDKRHQFICAEHDGHNSTVSTGHNISALYAAYYHHQIDGGNWFHLEWLRPLFSSWLVLNISWFLRRSPVSPVSRRI
DSQ  ATGGCTCATCAGTGTGCACGCTTCCATTTTTTCCTCTGTGGCTTCATCTGTTACCTTGTTCATAGTGCTTTGGCTTCGAATTCCAGCTCTACGCTATGTTTTTGGTTTCCATTGGCCCAC---GGCAACACATCATTCGAGCTGACCATCAACTACACCATATGCATGCCCTGTTCTACCAGTCAAGCGGCTCGCCAAAGGCTCGAGCCCGGTCGTAACATGTGGTGCAAAATAGGGCATGACAGGTGTGAGGAGCGTGACCATGATGAGTTGTTAATGTCCATCCCGTCCGGGTACGACAAC---CTCAAACTTGAGGGTTATTATGCTTGGCTGGCTTTTTTGTCCTTTTCCTACGCGGCCCAATTCCATCCGGAGTTGTTCGGGATAGGGAATGTGTCGCGCGTCTTCGTGGACAAGCGACACCAGTTCATTTGTGCCGAGCATGATGGACACAATTCAACCGTATCTACCGGACACAACATCTCCGCATTATATGCGGCATATTACCACCACCAAATAGACGGGGGCAATTGGTTCCATTTGGAATGGCTGCGGCCACTCTTTTCTTCCTGGCTGGTGCTCAACATATCATGGTTTCTGAGGCGTTCGCCTGTAAGCCCTGTTTCTCGACGCATC
TRN  10010101100011000
NAM  O55481_PRRSV/1-212
ASQ  MVNSCTFLHIFLCCSFLYSFCCAVVAGSNTTYCFWFPLVR-GNFSFELTVNYTVCPPCLTRQAAAEIYEPGRSLWCRIGYDRCEEDDHDELGFMVPPGLSSEGHLTGVYAWLAFLSFSYTAQFHPEIFGIGNVSRVYVDIKHQLICAEHDGQNTTLPRHDNISAVFQTYYQHQVDGGNWFHLEWLRPFFSSWLVLNVSWFLRRLPANHVSVRV
DSQ  ATGGTTAATAGCTGTACATTCCTCCATATTTTCCTCTGTTGCAGCTTCTTGTACTCTTTTTGTTGTGCTGTGGTTGCGGGTTCCAATACTACGTACTGTTTTTGGTTTCCGCTGGTTAGG---GGCAATTTTTCTTTCGAACTCACAGTGAATTACACGGTGTGTCCACCTTGCCTCACCCGGCAAGCAGCCGCAGAGATCTACGAACCCGGTAGGTCTCTTTGGTGCAGGATAGGGTATGACCGATGTGAGGAGGATGATCATGACGAGCTAGGGTTTATGGTACCGCCTGGCCTCTCCAGCGAAGGCCACTTGACTGGTGTTTACGCCTGGTTGGCGTTCTTGTCCTTCAGCTACACGGCCCAGTTCCATCCCGAGATATTCGGGATAGGGAATGTGAGTCGAGTTTATGTTGACATCAAACATCAACTCATCTGCGCCGAACATGACGGGCAGAACACCACCTTGCCTCGTCATGACAACATTTCAGCCGTGTTTCAGACCTATTACCAACATCAAGTCGACGGCGGCAATTGGTTTCACCTAGAATGGCTTCGTCCCTTCTTTTCCTCGTGGTTGGTTTTAAATGTCTCTTGGTTTCTCAGGCGTTTGCCTGCAAACCATGTTTCAGTTCGAGTC
TRN  10010101100011000
NAM  Q06499_LDV/1-191
ASQ  MASFNAIICVFICFSCCCIVDCNVTAP--TKTCLWFPIHETGKTHLELSLNFTLCKMCGVVENSYYSH-P----FCVT-DDTCEESSSQYLDFDFPDDVQL---LTSIYGTIAINALVFAIHQVPEMF--GNVTAIHFSEN--TLCYNS----TPIEHGKNVTTSLAIFDG---DVSKWYVLEYIRPLFSSWLVLNVSYFLRRSTAGRATRRL
DSQ  ATGGCTAGTTTCAATGCAATCATCTGTGTTTTCATCTGTTTCAGCTGCTGTTGCATTGTGGATTGTAATGTTACTGCGCCT------ACCAAAACGTGTCTTTGGTTTCCCATTCATGAAACGGGCAAGACGCATTTAGAGCTATCCCTGAATTTTACATTGTGTAAGATGTGCGGTGTGGTTGAGAATTCCTATTACTCCCAC---CCG------------TTTTGTGTTACA---GATGATACCTGCGAAGAGTCATCGTCGCAGTATCTTGATTTTGATTTTCCTGATGATGTCCAGTTG---------TTAACATCTATTTATGGTACCATAGCTATTAATGCCCTGGTGTTTGCCATCCATCAGGTCCCTGAAATGTTT------GGCAACGTTACTGCCATCCACTTCAGTGAAAAT------ACTTTGTGCTACAATAGC------------ACCCCAATAGAGCATGGAAAGAATGTAACCACATCATTGGCTATTTTTGATGGT---------GATGTGTCAAAATGGTATGTCTTAGAATATATCCGACCCTTGTTTTCATCTTGGTTGGTTTTGAATGTTTCTTATTTTCTCAGGCGCTCCACTGCCGGCCGTGCTACACGAAGGCTG
TRN  10010101100011000
//