EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01589 - Alpha_E1_glycop)
FAM  PF01589
PID  Alpha_E1_glycop
DES  Alphavirus E1 glycoprotein
IPR  IPR002548
ANO  8
ALN  505
AID  0.53858
APH  (Q08359_EEEV/740-1240:0.29159,((POLS_ONNVG/743-1246:0.36596,(POLS_RRVN/752-1254:0.15425,POLS_SFV/751-1253:0.11585):0.12641):0.15455,P89946_BFV/737-1238:0.33232):0.15418,((POLS_SINDO/747-1244:0.10594,POLS_WEEV/738-1235:0.18737):0.18862,Q86925_9VIRU/748-1243:0.26402):0.25926);
ATP  (Q08359_EEEV/740-1240,((POLS_ONNVG/743-1246,(POLS_RRVN/752-1254,POLS_SFV/751-1253)),P89946_BFV/737-1238),((POLS_SINDO/747-1244,POLS_WEEV/738-1235),Q86925_9VIRU/748-1243));
ATL  2.70032
DNO  5
DLN  1515
DID  0.568509
DPH  ((Q86925_9VIRU/748-1243:0.29637,(POLS_SINDO/747-1244:0.16136,POLS_WEEV/738-1235:0.21402):0.11531):0.22122,POLS_ONNVG/743-1246:0.40809,Q08359_EEEV/740-1240:0.25287);
DTP  ((Q86925_9VIRU/748-1243,(POLS_SINDO/747-1244,POLS_WEEV/738-1235)),POLS_ONNVG/743-1246,Q08359_EEEV/740-1240);
DTL  1.66924
RID  0.548244
RPH  ((Q86925_9VIRU/748-1243:0.26008,(POLS_SINDO/747-1244:0.10233,POLS_WEEV/738-1235:0.19140):0.18756):0.25323,POLS_ONNVG/743-1246:0.50842,Q08359_EEEV/740-1240:0.30029);
RTP  ((Q86925_9VIRU/748-1243,(POLS_SINDO/747-1244,POLS_WEEV/738-1235)),POLS_ONNVG/743-1246,Q08359_EEEV/740-1240);
RTL  1.80331
LNK  P89946_BFV/737-1238:P89946:
LNK  POLS_ONNVG/743-1246:P22056:M20303
LNK  POLS_RRVN/752-1254:P13890:
LNK  POLS_SFV/751-1253:P03315:
LNK  POLS_SINDO/747-1244:P27285:M69205
LNK  POLS_WEEV/738-1235:P13897:J03854
LNK  Q08359_EEEV/740-1240:Q08359:L20951
LNK  Q86925_9VIRU/748-1243:Q86925:AF126284
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q08359_EEEV/740-1240
ASQ  KPTRADDTLQVLNYLWNNNQNFFWMQTLIPLAALIVCMRMLRCLFCCGPA--FLLVCGA--LGAAAYEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTSIIPSTNLEYITCKYKTKVPSPVVKCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDLECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTANIHPAFKLQVCTSGVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSAFIVLGLIATAVVALVLFFH
DSQ  AAGCCGACGAGGGCAGACGACACCTTGCAAGTGCTGAATTATCTGTGGAACAACAATCAAAACTTTTTCTGGATGCAGACGCTTATCCCACTTGCAGCGCTTATCGTATGCATGCGCATGCTGCGCTGCTTATTTTGCTGTGGGCCGGCT------TTTTTACTTGTCTGCGGCGCC------TTGGGCGCCGCAGCGTACGAACACACAGCAGTGATGCCGAACAAGGTGGGGATCCCGTATAAAGCTTTAGTCGAACGCCCAGGTTATGCACCCGTTCACCTACAGATACAGCTGGTTAATACCAGCATAATTCCATCAACTAACCTGGAGTACATCACCTGCAAGTACAAGACAAAAGTGCCGTCTCCAGTAGTGAAATGCTGCGGTGCCACTCAATGTACCTCCAAACCCCATCCTGACTATCAGTGTCAGGTGTTTACAGGTGTTTACCCATTCATGTGGGGAGGAGCCTACTGCTTCTGCGACACCGAAAACACCCAGATGAGCGAGGCGTATGTAGAGCGCTCGGAAGAGTGCTCTATTGACCACGCAAAAGCTTATAAAGTACACACAGGCACTGTTCAGGCAATGGTGAACATAACTTATGGGAGCGTCAGCTGGAGATCTGCAGATGTCTACGTCAATGGTGAAACTCCCGCGAAAATAGGAGATGCCAAACTCATCATAGGTCCACTGTCATCTGCGTGGTCCCCATTCGATAACAAGGTGGTGGTTTATGGGCATGAAGTGTATAATTACGACTTTCCTGAGTACGGCACCGGCAAAGCAGGCTCTTTTGGAGACCTGCAATCACGCACATCAACCAGCAACGATCTGTACGCAAACACCAACTTGAAGCTACAACGACCCCAGGCTGGTATCGTGCACACACCTTTCACCCAGGCGCCCTCTGGCTTCGAACGATGGAAAAGGGACAAAGGGGCACCGTTGAACGACGTAGCCCCGTTTGGCTGTTCGATTGCCCTGGAGCCGCTCCGTGCAGAAAATTGCGCAGTGGGAAGCATCCCTATATCTATAGATATACCCGATGCGGCTTTCACCAGAATATCTGAAACACCGACAGTCTCAGACCTGGAATGCAAAATTACGGAGTGTACTTATGCCTCCGATTTCGGTGGTATAGCCACCGTTGCCTACAAATCCAGTAAAGCAGGAAACTGTCCAATTCATTCTCCATCAGGTGTTGCAGTTATTAAAGAGAATGACGTCACTCTTGCTGAGAGCGGATCATTTACATTCCACTTCTCCACTGCAAACATCCATCCTGCTTTTAAGCTGCAGGTCTGCACCAGTGGAGTTACCTGCAAAGGAGATTGCAAGCCACCGAAAGATCACATCGTCGATTATCCAGCACAACATACCGAATCCTTTACGTCGGCGATATCCGCCACCGCGTGGTCGTGGCTAAAAGTGCTGGTAGGAGGAACATCAGCATTTATTGTTCTGGGGCTTATTGCTACAGCAGTGGTTGCCCTAGTTCTGTTCTTCCAT
TRN  10010101100011000
NAM  P89946_BFV/737-1238
ASQ  AKSARADTLDDFSYLWTNNQAMFWLQLASPVAAFLCLSYCCRNLACCMK--IFLGISGLCVIATQAYEHSTTMPNQVGIPFKALIERPGYAGLPLSLVVIKSELVPSLVQDYITCNYKTVVPSPYIKCCGGAECSHKNEADYKCSVFTGVYPFMWGGAYCFCDTENSQMSEVYVTRGESCEADHAIAYQVHTASLKAQVMISIGELNQ-TVDVFVNGDSPARIQQSKFILGPISSAWSPFDHKVIVYRDEVYNEDYAPYGSGQAGRFGDIQSRTVNSTDVYANTNLKLKRPASGNVHVPYTQTPSGFSYWKKEKGVPLNRNAPFGCIIKVNPVRAENCVYGNIPISMDIADAHFTRIDESPSVSLKACEVQSCTYSSDFGGVASISYTSNKVGKCAIHSHSNSATMKDSVQDVQESGALSLFFATSSVEPNFVVQVCNARITCHGKCEPPKDHIVPYAAKHNDAEFPSISTTAWQWLAHTTSGPLTILVVAIIVVVVVSIVVCAR
NAM  POLS_SFV/751-1253
ASQ  PRAHAASVAETMAYLWDQNQALFWLEFAAPVACILIITYCLRNVLCCCKSLSFLVLLSLGA-TARAYEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYVKCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHASAYKAHTASLKAKVRVMYGNVNQ-TVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVYKDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGFKYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLTCTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTASASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQKISGGLGAFAIGAILVLVVVTCIGLRR
NAM  POLS_RRVN/752-1254
ASQ  PRANAASFAETMAYLWDENKTLFWMEXXXXXXALALLACCIKSLICCCKPFSFLVLLSLGA-SAKAYEHTATIPNVVGFPYKAHIERNXFSPMTLQLEVVXXSLEPTLNLEYITCEYKTVVPSPFIKCCGTSECSSKEQPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCKHDHALAYKAHTASLKATIRISYGTINQ-TTEAFVNGEHAVNVGGSKFIFGPISTAWSPFDNKIVVYKDDVYNQDFPPYGSGQPGRFGDIQSRTVESKDLYANTALKLSRPSPGVVHVPYTQTPSGFKYWLKEKGSSLNTKAPFGCKIKTNPVRAMDCAVGSIPVSMDIPDSAFTRVVDAPAVTDLSCQVAVCTHSSDFGXVATLSYKTDKPGKCAVHSHSNVATLQEATVDVKEDGKVTVHFSXXSASPAFKVSVCDAKTTCTAACEPPKDHIVPYGASHNNQVFPDMSGTAMTWVQRMASGLGGLALIAVVVLVLVTCITMRR
NAM  POLS_ONNVG/743-1246
ASQ  RTAKAASYYEAATYLWNEQQPLFWLQLLIPLSAAIVVCNCLKLLPCCCKTLTFLAVMSIGARTVTAYEHATVIPNTVGVPCKTLVSRPGYSPMVLEMELQSVTLEPALSLDYITCEYKTITPSPYVKCCGTAECKAKNLPDYNCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFASAYRAHTASVSAKLRVFYQGNNI-TVSAYANGDHAVTVEDAKFVIGPLSSAWSPFDNKIVVYKGEVYNMDYPPFGAGRPGQFGDIQSRTPDSKDVYANTQLILQRPAAGAIHVPYSQAPSGFKYWLKEKGASLQHTAPFGCQIATNPVRAVNCAVGNIPVSIDIPDAAFTRVTDAPSITDMSCEVASCTHSSDFGGAAVIKYTASKKGKCAVHSVTNAVTIREPNVDVKGTAQLQIAFSTALASAEFKVQICSTLVHCSATCHPPKDHIVNYPSPHTTLGVQDISTTAMSWVQKITGGVGLVVAIAALILIIVLCVSFSR
DSQ  AGGACTGCAAAAGCAGCATCGTACTACGAAGCTGCAACATACCTCTGGAATGAGCAACAACCATTATTTTGGTTACAGCTTCTAATCCCTCTGTCAGCTGCAATTGTTGTGTGTAATTGCCTAAAACTTTTACCATGCTGCTGCAAAACATTGACTTTTTTAGCCGTCATGAGCATCGGTGCCCGCACTGTGACCGCGTACGAGCACGCAACAGTGATCCCGAACACGGTGGGAGTACCGTGTAAGACTCTTGTTAGCAGACCAGGGTACAGCCCTATGGTCTTAGAAATGGAGCTACAGTCGGTCACTCTGGAACCAGCATTATCCTTGGATTACATTACGTGTGAGTATAAAACAATCACACCGTCCCCGTACGTAAAATGCTGTGGTACAGCTGAATGTAAGGCCAAGAACCTGCCAGATTATAACTGCAAAGTATTCACAGGCGTCTACCCATTTATGTGGGGAGGAGCATACTGCTTCTGTGACGCAGAGAACACACAGCTCAGCGAGGCACACGTTGAGAAATCAGAATCATGCAAAACTGAGTTTGCATCAGCCTACAGAGCCCACACAGCTTCAGTATCAGCTAAACTACGTGTCTTTTACCAAGGGAATAATATC---ACCGTGTCTGCATACGCCAATGGTGATCATGCAGTTACGGTGGAAGACGCGAAGTTTGTCATCGGTCCACTATCGTCCGCCTGGTCACCATTTGATAATAAGATCGTGGTGTACAAAGGCGAAGTCTACAATATGGACTATCCACCTTTCGGCGCAGGGAGGCCAGGACAGTTCGGTGACATCCAGAGCCGCACGCCAGACAGCAAGGACGTCTATGCGAATACGCAGTTAATACTGCAAAGACCAGCGGCAGGAGCAATACACGTGCCTTACTCCCAGGCACCTTCGGGCTTTAAGTACTGGCTCAAGGAAAAAGGGGCATCATTGCAGCATACTGCACCATTTGGCTGTCAGATAGCAACAAACCCGGTAAGAGCAGTGAACTGTGCAGTGGGCAACATACCAGTCTCCATTGACATCCCAGATGCAGCTTTCACCAGGGTCACTGACGCTCCTTCCATCACAGACATGTCCTGCGAAGTAGCTTCGTGTACCCATTCATCTGATTTTGGAGGTGCCGCAGTCATAAAGTACACAGCTAGTAAAAAAGGAAAATGCGCCGTGCACTCTGTAACAAATGCGGTCACTATCCGCGAACCTAACGTAGATGTCAAGGGAACAGCACAATTGCAAATTGCCTTCTCGACCGCACTAGCTAGTGCGGAATTCAAGGTGCAGATCTGCTCCACACTGGTACACTGCTCAGCGACGTGCCATCCTCCTAAAGACCATATAGTCAATTACCCGTCACCTCACACCACACTAGGAGTGCAGGACATTTCAACGACAGCTATGTCTTGGGTCCAGAAGATTACAGGAGGAGTGGGACTCGTGGTTGCTATAGCTGCTTTGATCTTAATTATAGTTCTCTGCGTATCATTTAGCAGA
TRN  10010101100011000
NAM  Q86925_9VIRU/748-1243
ASQ  QRTSADEFTDTMGYLWQHSQTMFWIQLVIPLAAVIT---LVRCCSCCLP---FLLVASP-PNKADAYEHTITVPNAPLNSYKALVERPGYAPLNLEVMVMNTQIIPSVKREYITCRYHTVVPSPQIKCCGTVECPKGEKADYTCKVFTGVYPFLWGGAQCFCDSENSQLSDKYVELSTDCATDHAEAVRVHTASVKSQLRITYGNSTA-QVDVFVNGVTPARSKDMKLIAGPLSTTFSPFDNKVIIYHGKVYNYDFPEFGAGTPGAFGDVQASSTTGSDLLANTAIHLQRPEARNIHVPYTQAPSGFEFWKNNSGQPLSDTAPFGCKVNVNPLRADKCAVGSLPISVDIPDAAFTRVS-EPLPSLLKCTVTSCTYSTDYGGVLVLTYESDRAGQCAVHSHSSTAVLRDPSVYVEQKGETTLKFSTRSLQADFEVSMCGTRTTCHAQCQPPTEHVMNRPQKSTPDFSSAISKTSWNWITALMGGISSIAAIAAIVLVIALVFTAQH
DSQ  CAACGGACTTCAGCGGATGAATTTACCGATACCATGGGGTACCTATGGCAACACAGTCAAACAATGTTCTGGATACAATTGGTCATACCTTTAGCAGCAGTGATAACT---------TTGGTTAGATGTTGCTCCTGCTGTCTACCT---------TTTTTATTGGTTGCCAGTCCT---CCTAACAAAGCGGACGCCTACGAACATACGATCACTGTCCCAAATGCGCCGTTGAACTCGTATAAAGCACTAGTGGAACGGCCTGGGTATGCCCCCTTGAATCTTGAAGTCATGGTCATGAACACCCAGATCATACCATCGGTTAAACGTGAATACATTACCTGCAGGTACCACACCGTTGTTCCTTCACCGCAGATTAAATGTTGCGGAACTGTCGAATGCCCGAAAGGTGAAAAAGCAGACTATACCTGCAAGGTGTTCACTGGTGTGTACCCATTTCTGTGGGGAGGAGCACAGTGTTTTTGCGACTCCGAAAACAGTCAGCTTAGCGACAAGTACGTCGAACTGTCAACAGATTGCGCCACAGACCATGCCGAGGCGGTCAGAGTACACACGGCTTCGGTGAAATCACAGCTCCGAATAACCTACGGGAACTCCACAGCA---CAAGTAGACGTATTTGTCAACGGTGTGACTCCAGCCAGGAGCAAAGACATGAAATTGATAGCCGGCCCATTATCTACTACATTTTCCCCGTTTGATAATAAGGTCATTATATATCATGGGAAAGTCTATAACTATGACTTCCCGGAATTTGGGGCCGGAACACCTGGAGCTTTCGGAGATGTCCAAGCGTCATCCACCACCGGATCAGATCTATTAGCAAACACAGCAATTCATTTGCAGAGGCCGGAAGCCAGAAACATACACGTCCCGTACACCCAAGCTCCAAGCGGGTTCGAATTCTGGAAGAATAACAGCGGTCAGCCTTTATCTGACACTGCCCCTTTCGGATGCAAAGTCAATGTCAACCCGCTACGTGCAGACAAGTGTGCCGTGGGATCACTCCCGATATCCGTGGATATACCGGACGCTGCATTTACACGCGTATCC---GAGCCCCTGCCATCACTGCTTAAGTGCACCGTTACTAGTTGCACATACTCTACAGACTATGGCGGAGTGCTCGTGTTGACATACGAGTCGGATCGCGCGGGGCAATGCGCTGTACACTCGCATTCATCAACAGCGGTACTGCGAGACCCATCGGTATACGTCGAGCAAAAAGGGGAGACTACACTTAAATTTAGTACGCGTTCCTTGCAGGCAGACTTCGAGGTATCGATGTGCGGAACGAGAACCACTTGCCATGCCCAATGTCAACCACCAACGGAACACGTAATGAACAGACCCCAGAAGTCGACTCCAGACTTCTCCTCAGCGATATCCAAAACATCATGGAACTGGATTACAGCGCTTATGGGGGGAATTTCCAGTATAGCTGCTATAGCCGCAATTGTGCTGGTCATAGCATTAGTATTTACAGCACAACAC
TRN  10010101100011000
NAM  POLS_WEEV/738-1235
ASQ  RPTNAETFGETLNHLWFNNQPFLWAQLCIPLAALVI---LFRCFSCCMP---FLLVAGVCLGKVDAFEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTNKEYVTCRFHTVIPSPQVKCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPDCTIDHAVALKVHTAALKVGLRIVYGNTTA-HLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMKPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASNCAYGHIPISIDIPDAAFVRSSESPTILEVSCTVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAVGSITLHFSTSSPQANFIVSLCGKKTTCNAECKPPADHIIGEPHKVDQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSSMLINTR
DSQ  CGGCCAACCAACGCTGAAACATTTGGAGAAACTTTGAACCATCTGTGGTTTAACAACCAACCGTTTCTCTGGGCACAGTTGTGCATCCCTCTGGCAGCGCTTGTTATT---------CTGTTCCGCTGCTTTTCATGCTGCATGCCT---------TTTTTATTGGTTGCAGGCGTCTGCCTGGGGAAGGTAGACGCCTTCGAACATGCGACCACTGTGCCAAATGTTCCGGGGATCCCGTATAAGGCGTTGGTCGAACGTGCAGGTTACGCGCCACTTAATCTGGAGATCACTGTCGTCTCATCGGAATTAACACCCTCAACTAACAAGGAGTACGTGACCTGCAGATTCCACACAGTCATTCCTTCACCACAAGTTAAATGCTGCGGGTCCCTCGAGTGTAAGGCATCCTCAAAAGCGGATTACACATGCCGCGTTTTTGGCGGTGTGTACCCTTTCATGTGGGGAGGCGCACAGTGCTTCTGTGACAGTGAGAACACACAACTGAGTGAGGCATACGTCGAGTTCGCTCCAGACTGCACTATTGATCATGCAGTCGCACTAAAAGTTCACACAGCTGCTCTGAAAGTCGGCCTGCGTATAGTATACGGCAATACCACCGCG---CACCTGGATACGTTCGTCAATGGCGTCACGCCAGGTTCCTCACGGGACCTGAAGGTCATAGCAGGGCCGATATCAGCCGCTTTTTCACCCTTTGACCATAAGGTCGTCATCAGAAAGGGGCTTGTTTACAACTACGACTTCCCTGAATATGGAGCTATGAAACCAGGAGCGTTCGGCGATATTCAAGCATCCTCGCTTGATGCCACAGACATAGTAGCCCGCACTGACATACGGCTGCTGAAGCCTTCTGTCAAGAACATCCACGTCCCCTACACCCAAGCAGTATCAGGGTATGAAATGTGGAAGAACAACTCAGGACGACCCCTGCAAGAAACAGCACCATTTGGATGTAAAATTGAAGTGGAGCCTCTGCGAGCGTCTAACTGTGCTTACGGGCACATCCCTATCTCGATTGACATCCCTGACGCAGCTTTTGTGAGATCATCAGAATCACCAACAATTTTAGAAGTTAGCTGCACAGTAGCAGACTGCATTTATTCTGCAGACTTTGGTGGTTCGCTAACATTACAGTACAAAGCTGACAGGGAGGGACATTGTCCAGTTCACTCCCACTCCACAACAGCTGTTTTGAAGGAAGCGACCACACATGTGACTGCCGTAGGCAGCATAACACTACATTTTAGCACATCGAGCCCACAAGCAAATTTTATAGTTTCGCTATGCGGCAAGAAGACCACCTGCAATGCTGAATGTAAACCACCGGCCGACCACATAATTGGAGAACCACATAAAGTCGACCAAGAATTCCAGGCGGCAGTTTCCAAAACATCTTGGAATTGGCTGCTTGCACTGTTTGGGGGAGCATCATCCCTCATTGTTGTAGGACTTATAGTGTTGGTCTGCAGCTCTATGCTTATAAACACACGT
TRN  10010101100011000
NAM  POLS_SINDO/747-1244
ASQ  RSANAETFTETMSYFWSNSQPFFWVQLCIPLAAVIV---LMRCCSCCLP---FLVVAGAYLAKVDAYEHATTVPNVPQIPYKALVERAGYAPLNLEITVMSSEVLPSTNQEYITCKFTTVVPSPKVKCCGSLECQPAAHADYTCKVFGGVYPFMWGGAQCFCDSENSQMSEAYVELSADCATDHAQAIKVHTAAMKVGLRIVYGNTTS-FLDVYVNGVTPGTSKDLKVIAGPISASFTPFDHKVVIHRGLVYNYDFPEYGAMKPGVFGDIQATSLTSKDLIASTDIRLLKPSAKNVHVPYTQAASGFEMWKNNSGRPLQETAPFGCKIAVNPLRAVDCSYGNIPISIDIPNAAFIRTSDAPLVSTVKCDVSECTYSADFGGMATLQYVSDREGQCPVHSHSSTATLQESTVHVLEKGAVTVHFSTASPQANFIVSLCGKKTTCNAECKPPADHIVSTPHKNDQEFQAAISKTSWSWLFALFGGASSLLIIGLTIFACSMMLTSTR
DSQ  AGGTCGGCTAACGCTGAAACGTTCACCGAGACCATGAGTTATTTCTGGTCGAACAGCCAGCCGTTCTTCTGGGTCCAGCTGTGCATACCCTTGGCCGCTGTCATCGTC---------CTAATGCGCTGTTGCTCCTGCTGCCTGCCT---------TTTTTAGTGGTTGCCGGCGCCTACCTGGCGAAGGTAGACGCCTACGAACATGCGACCACTGTTCCAAATGTGCCACAGATACCGTATAAGGCACTTGTTGAAAGGGCAGGGTACGCCCCGCTCAATCTGGAGATTACTGTCATGTCCTCGGAGGTTTTACCTTCCACCAACCAAGAGTACATCACTTGTAAATTCACTACCGTGGTCCCCTCCCCTAAAGTCAAATGCTGCGGCTCCTTGGAATGTCAGCCCGCCGCTCACGCAGACTATACCTGCAAGGTCTTTGGAGGGGTGTACCCCTTCATGTGGGGAGGAGCACAATGTTTTTGCGACAGTGAGAACAGCCAGATGAGTGAGGCGTACGTCGAATTGTCAGCAGATTGCGCGACTGACCACGCGCAGGCGATTAAGGTACATACTGCCGCGATGAAAGTAGGACTGCGTATAGTGTACGGGAACACTACCAGT---TTCCTAGATGTGTACGTGAACGGAGTTACACCAGGAACGTCTAAAGACCTGAAAGTCATAGCTGGACCGATTTCAGCATCGTTTACACCATTCGATCACAAGGTCGTTATCCATCGCGGCCTGGTGTACAACTATGACTTCCCGGAATACGGAGCGATGAAACCAGGAGTGTTTGGAGACATTCAAGCTACCTCCTTGACTAGCAAAGACCTCATCGCCAGCACAGACATTAGGCTACTTAAGCCTTCCGCCAAGAACGTGCATGTCCCGTACACGCAGGCCGCATCAGGATTCGAGATGTGGAAAAACAACTCAGGCCGCCCACTGCAGGAAACCGCCCCTTTCGGGTGTAAGATCGCAGTCAATCCGCTTCGAGCGGTGGACTGCTCATACGGGAACATTCCCATTTCTATTGACATCCCGAACGCTGCCTTTATCAGGACATCAGATGCACCACTGGTCTCAACAGTCAAATGTGATGTCAGTGAGTGCACTTATTCAGCAGACTTCGGCGGGATGGCCACCCTGCAGTATGTATCCGACCGCGAAGGACAATGCCCTGTACATTCGCATTCAAGCACAGCAACCCTCCAAGAGTCGACAGTTCATGTCCTGGAGAAAGGAGCGGTGACAGTACACTTCAGCACCGCGAGTCCACAGGCGAACTTCATTGTATCGCTGTGCGGTAAGAAGACAACATGCAATGCAGAATGTAAACCACCAGCTGACCATATCGTGAGCACCCCGCACAAAAATGACCAAGAATTCCAAGCCGCCATCTCAAAAACATCATGGAGTTGGCTGTTTGCCCTTTTCGGCGGCGCCTCGTCGCTATTAATTATAGGACTTACGATTTTTGCTTGCAGCATGATGCTGACTAGCACACGA
TRN  10010101100011000
//