EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01524 - Gemini_V1)
FAM  PF01524
PID  Gemini_V1
DES  Geminivirus V1 protein
IPR  IPR002511
ANO  18
ALN  80
AID  0.578239
APH  (Q9ICG0_9GEMI/1-78:0.26665,(((Q99DS0_9GEMI/1-78:0.48685,O55375_9GEMI/1-77:0.85151):0.11700,Q9QS59_9GEMI/4-83:0.56909):0.16732,((Q9YYU1_9GEMI/1-78:0.19378,Q9IN51_9GEMI/1-78:0.10931):0.09506,(Q9IR65_9GEMI/1-78:0.07146,((((O91270_9GEMI/1-78:0.08165,Q9WPL9_9GEMI/1-78:0.64365):0.10116,Q992L9_9GEMI/4-81:0.25460):0.04690,(O56988_9GEMI/1-78:0.09105,O72714_9GEMI/1-78:0.28073):0.03240):0.02643,(Q9QD51_9GEMI/1-78:0.22484,(((Q9JEA6_9GEMI/1-78:0.19794,O92601_TYLCV/1-78:0.02676):0.11474,O12276_9GEMI/1-78:0.13017):0.02995,Q88556_9GEMI/1-78:0.18455):0.04339):0.03732):0.07335):0.07040):0.11803):0.02536,YV1_TYLCA/1-78:0.21384);
ATP  (Q9ICG0_9GEMI/1-78,(((Q99DS0_9GEMI/1-78,O55375_9GEMI/1-77),Q9QS59_9GEMI/4-83),((Q9YYU1_9GEMI/1-78,Q9IN51_9GEMI/1-78),(Q9IR65_9GEMI/1-78,((((O91270_9GEMI/1-78,Q9WPL9_9GEMI/1-78),Q992L9_9GEMI/4-81),(O56988_9GEMI/1-78,O72714_9GEMI/1-78)),(Q9QD51_9GEMI/1-78,(((Q9JEA6_9GEMI/1-78,O92601_TYLCV/1-78),O12276_9GEMI/1-78),Q88556_9GEMI/1-78)))))),YV1_TYLCA/1-78);
ATL  5.97724
DNO  18
DLN  240
DID  0.644777
DPH  ((((((((((O92601_TYLCV/1-78:0.08671,Q9JEA6_9GEMI/1-78:0.12744):0.08049,Q9QD51_9GEMI/1-78:0.20224):0.02948,(O56988_9GEMI/1-78:0.12267,((Q88556_9GEMI/1-78:0.18068,O12276_9GEMI/1-78:0.12005):0.04201,(Q992L9_9GEMI/4-81:0.18960,O91270_9GEMI/1-78:0.16448):0.06813):0.03363):0.05084):0.03696,(Q9IR65_9GEMI/1-78:0.14816,Q9YYU1_9GEMI/1-78:0.17375):0.05315):0.03960,Q9IN51_9GEMI/1-78:0.14265):0.06043,YV1_TYLCA/1-78:0.16281):0.05201,Q9ICG0_9GEMI/1-78:0.17376):0.05269,O72714_9GEMI/1-78:0.19676):0.07144,(O55375_9GEMI/1-77:0.57282,Q99DS0_9GEMI/1-78:0.19939):0.06321):0.07250,Q9QS59_9GEMI/4-83:0.44578,Q9WPL9_9GEMI/1-78:0.36039);
DTP  ((((((((((O92601_TYLCV/1-78,Q9JEA6_9GEMI/1-78),Q9QD51_9GEMI/1-78),(O56988_9GEMI/1-78,((Q88556_9GEMI/1-78,O12276_9GEMI/1-78),(Q992L9_9GEMI/4-81,O91270_9GEMI/1-78)))),(Q9IR65_9GEMI/1-78,Q9YYU1_9GEMI/1-78)),Q9IN51_9GEMI/1-78),YV1_TYLCA/1-78),Q9ICG0_9GEMI/1-78),O72714_9GEMI/1-78),(O55375_9GEMI/1-77,Q99DS0_9GEMI/1-78)),Q9QS59_9GEMI/4-83,Q9WPL9_9GEMI/1-78);
DTL  4.5767
RID  0.578239
RPH  (Q9ICG0_9GEMI/1-78:0.26665,(((Q99DS0_9GEMI/1-78:0.48685,O55375_9GEMI/1-77:0.85151):0.11700,Q9QS59_9GEMI/4-83:0.56909):0.16732,((Q9YYU1_9GEMI/1-78:0.19378,Q9IN51_9GEMI/1-78:0.10931):0.09506,(Q9IR65_9GEMI/1-78:0.07146,((((O91270_9GEMI/1-78:0.08165,Q9WPL9_9GEMI/1-78:0.64365):0.10116,Q992L9_9GEMI/4-81:0.25460):0.04690,(O56988_9GEMI/1-78:0.09105,O72714_9GEMI/1-78:0.28073):0.03240):0.02643,(Q9QD51_9GEMI/1-78:0.22484,(((Q9JEA6_9GEMI/1-78:0.19794,O92601_TYLCV/1-78:0.02676):0.11474,O12276_9GEMI/1-78:0.13017):0.02995,Q88556_9GEMI/1-78:0.18455):0.04339):0.03732):0.07335):0.07040):0.11803):0.02536,YV1_TYLCA/1-78:0.21384);
RTP  (Q9ICG0_9GEMI/1-78,(((Q99DS0_9GEMI/1-78,O55375_9GEMI/1-77),Q9QS59_9GEMI/4-83),((Q9YYU1_9GEMI/1-78,Q9IN51_9GEMI/1-78),(Q9IR65_9GEMI/1-78,((((O91270_9GEMI/1-78,Q9WPL9_9GEMI/1-78),Q992L9_9GEMI/4-81),(O56988_9GEMI/1-78,O72714_9GEMI/1-78)),(Q9QD51_9GEMI/1-78,(((Q9JEA6_9GEMI/1-78,O92601_TYLCV/1-78),O12276_9GEMI/1-78),Q88556_9GEMI/1-78)))))),YV1_TYLCA/1-78);
RTL  5.97724
LNK  O12276_9GEMI/1-78:O12276:U88692
LNK  O55375_9GEMI/1-77:O55375:AF029217
LNK  O56988_9GEMI/1-78:O56988:Y15934
LNK  O72714_9GEMI/1-78:O72714:AJ002452
LNK  O91270_9GEMI/1-78:O91270:Y16421
LNK  O92601_TYLCV/1-78:O92601:AJ010790
LNK  Q88556_9GEMI/1-78:Q88556:Z48182
LNK  Q992L9_9GEMI/4-81:Q992L9:AF327436
LNK  Q99DS0_9GEMI/1-78:Q99DS0:AF314530
LNK  Q9ICG0_9GEMI/1-78:Q9ICG0:AF126806
LNK  Q9IN51_9GEMI/1-78:Q9IN51:AF155064
LNK  Q9IR65_9GEMI/1-78:Q9IR65:AB020781
LNK  Q9JEA6_9GEMI/1-78:Q9JEA6:AF126802
LNK  Q9QD51_9GEMI/1-78:Q9QD51:AF189018
LNK  Q9QS59_9GEMI/4-83:Q9QS59:AF104036
LNK  Q9WPL9_9GEMI/1-78:Q9WPL9:AF136222
LNK  Q9YYU1_9GEMI/1-78:Q9YYU1:AF014881
LNK  YV1_TYLCA/1-78:P36282:S53251
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  YV1_TYLCA/1-78
ASQ  MWDPLVHEFPETVHGFRCMLANKYLLAVESKYAPDTLGYELIRDCIGVVRSRNYEQATSRYRDIYTRL..QGATEAELQQ
DSQ  ATGTGGGATCCTTTAGTCCACGAATTTCCTGAAACCGTTCACGGTTTCCGTTGTATGCTCGCCAACAAATATTTGTTGGCTGTTGAATCAAAATACGCTCCGGATACATTGGGATACGAATTGATCAGGGATTGCATTGGGGTTGTTAGGTCTCGAAATTATGAGCAAGCGACCAGCAGATATCGTGATATCTACACCCGCCTC......CAAGGTGCGACGGAAGCTGAACTTCAACAG
TRN  10010101110011000
NAM  Q9ICG0_9GEMI/1-78
ASQ  MWDPLVNDFPETVHGFRSMLAVKYLLHLEQEYDRGTVGAEYIRDLIGVLRCKNYVEATRRYNNLNTRI..QGAEEAELRQ
DSQ  ATGTGGGATCCATTGGTGAACGATTTTCCCGAAACCGTTCACGGTTTCCGTTCTATGCTTGCTGTTAAATACCTGTTACATTTGGAACAGGAATACGATCGCGGTACTGTCGGGGCTGAGTATATACGGGATCTAATAGGGGTTCTACGGTGTAAGAATTATGTCGAAGCGACCAGGAGATATAATAATCTCAACACCCGTATC......CAAGGTGCGGAGGAGGCTGAACTTCGACAG
TRN  10010101100011010
NAM  Q9YYU1_9GEMI/1-78
ASQ  MWDPLVNDFPATVHGFRCMLAIKYIQAVRSEYDPGSLGFDLLSDLIGVLRAGNYVEATGRYHNFHSRL..EGTTSSELRQ
DSQ  ATGTGGGATCCTTTGGTGAATGATTTCCCGGCAACCGTGCACGGTTTTCGGTGTATGTTAGCTATAAAATATATTCAGGCGGTTAGGTCCGAATACGATCCCGGTAGTTTAGGGTTTGATTTATTGTCTGATTTAATAGGTGTTCTTCGTGCCGGGAATTATGTCGAAGCGACCGGCAGATATCATAATTTCCACTCCCGCCTC......GAAGGTACGACGTCGTCTGAACTTCGACAG
TRN  10010101110011010
NAM  Q9IN51_9GEMI/1-78
ASQ  MWDPLLNDFPESVHGFRCMLAVKYLQAVRESYDPSTLGYDLLSDLIGVVRRTNYVEATSRYHHFHSRL..ESASPSELRQ
DSQ  ATGTGGGATCCGTTATTGAACGACTTCCCTGAATCCGTTCACGGTTTCCGTTGTATGCTCGCCGTGAAATATTTGCAGGCTGTTCGAGAGTCGTACGATCCTTCCACTCTTGGGTACGATCTTCTTAGCGATCTCATCGGAGTTGTTCGCCGTACCAACTATGTCGAAGCGACCAGCAGATATCATCATTTCCACTCCCGCCTC......GAAAGTGCGTCGCCGTCTGAACTTCGACAG
TRN  10010101110011010
NAM  Q9QD51_9GEMI/1-78
ASQ  MWDPLLNEFPDSVHGFRCMLAIKYLQGVEATYAPDTVGYDLVRDLISVVRASNYAEACRRYSLFRSRI..ESTPSSQLRQ
DSQ  ATGTGGGATCCTCTTTTAAACGAATTTCCGGATTCTGTTCACGGTTTTCGGTGTATGCTCGCAATAAAGTATTTGCAAGGCGTTGAAGCAACCTACGCCCCTGATACTGTCGGTTACGACCTAGTTCGAGATCTGATCTCAGTTGTTCGTGCGAGCAATTATGCTGAAGCGTGCCGGAGATATAGCCTTTTCCGGTCCCGTATC......GAAAGTACGCCGTCGTCTCAATTACGACAG
TRN  10010101100011000
NAM  Q9JEA6_9GEMI/1-78
ASQ  MWDPLVNEFPDSVHGLRCMLAIKYLQALEDTYEPSTLGHDLVRDLVSVIRARNYVEATRRYHHFHSRL..QGSSKTELRQ
DSQ  ATGTGGGATCCACTGGTGAATGAGTTTCCAGACTCGGTGCATGGGCTTAGGTGTATGCTTGCAATTAAATATTTGCAGGCCTTAGAGGATACATACGAGCCCAGTACTTTGGGCCACGATCTGGTTAGGGATCTAGTCTCAGTTATCAGGGCTCGTAATTATGTCGAAGCGACCAGGAGATATCATCATTTCCACTCCAGGCTC......CAAGGTTCGTCGAAGACTGAACTTCGACAG
TRN  10010101100011000
NAM  O92601_TYLCV/1-78
ASQ  MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDLISVVRARDYVEATRRYNHFHARL..EGSPKAELRQ
DSQ  ATGTGGGATCCACTTCTAAATGAATTTCCTGAATCTGTTCACGGATTTCGTTGTATGTTAGCTATTAAATATTTGCAGTCCGTTGAGGAAACTTACGAGCCCAATACATTGGGCCACGATTTAATTAGGGATCTTATATCTGTTGTAAGGGCCCGTGACTATGTCGAAGCGACCAGGCGATATAATCATTTCCACGCCCGCCTC......GAAGGTTCGCCGAAGGCTGAACTTCGACAG
TRN  10010101110011010
NAM  Q9IR65_9GEMI/1-78
ASQ  MWDPLLNDFPETVHGFRCMLAVKYLLLVEATYSPDTVGYDLIRDLIGVVRAKNYVEATSRYRDFHSRI..QGTSPSELRR
DSQ  ATGTGGGATCCTTTACTTAACGATTTCCCTGAAACCGTACACGGTTTTCGGTGTATGCTAGCGGTTAAATACCTTCTTCTGGTTGAGGCTACATACTCTCCGGATACGGTGGGTTACGATCTAATACGCGATCTTATAGGTGTTGTTCGTGCGAAGAATTATGTCGAAGCGACCAGCAGATATAGGGATTTTCACTCCCGCATT......CAGGGCACGTCGCCGTCTGAACTTCGACGG
TRN  10010101100011010
NAM  O12276_9GEMI/1-78
ASQ  MWDPLLNDFPESVHGLRCMLAIKYLHFVENTYSPDTLGYDLIRDLILVIRARDYVEATRRYSHFHSRF..QGSSPSELRQ
DSQ  ATGTGGGATCCACTTTTAAATGATTTTCCGGAGTCTGTGCATGGTCTACGGTGTATGCTTGCCATTAAGTATCTACATTTTGTAGAAAATACATATTCCCCGGATACTTTGGGTTACGATCTCATACGTGATTTGATTTTAGTTATCCGTGCTAGAGATTATGTCGAAGCGACCCGCCGATATAGTCATTTCCACTCCCGCTTC......CAAGGTTCGTCGCCGTCTGAACTTCGCCAG
TRN  10010101110011010
NAM  O91270_9GEMI/1-78
ASQ  MWDPLLHEFPESVHGLRCMLAVKYLQEIEKNYSPDTVGYDLVRDLILVLRAKNYGEATSRYHHFNARI..EGSPTSQLRQ
DSQ  ATGTGGGATCCATTGTTGCACGAATTTCCAGAAAGCGTTCATGGTCTAAGGTGCATGCTAGCTGTAAAATATCTCCAAGAGATAGAAAAGAACTACTCCCCAGACACAGTCGGCTACGATCTTGTCCGAGATCTCATTCTTGTTCTCCGAGCAAAGAACTATGGCGAAGCGACCAGCAGATATCATCATTTCAACGCCCGCATC......GAAGGTTCGCCGACGTCTCAACTTCGACAG
TRN  10010101110011011
NAM  O56988_9GEMI/1-78
ASQ  MWDPLLNEFPETVHGFICMLAVKYLQLLKKTYSPDTLGYDLFRDLISVIRARNYVEATSRYIHFHARF..EGTPPSQLRQ
DSQ  ATGTGGGATCCATTGTTGAACGAGTTTCCCGAAACCGTCCACGGTTTTATATGTATGTTAGCAGTTAAATATCTGCAGTTATTAAAAAAGACTTATTCTCCTGACACATTAGGTTACGATTTATTTAGGGATTTAATTTCAGTTATTAGGGCTAGAAATTATGTCGAAGCGACCAGCAGATATATTCATTTCCACGCCCGCTTC......GAAGGTACGCCGCCGTCTCAACTTCGACAG
TRN  10010101100011000
NAM  Q88556_9GEMI/1-78
ASQ  MWDPLTNDFPETVHGFRCMLAIKYLQLVENTYSPDSLGYDLIRDLISVVRAKSYVQASGRYDHFRARL..EVSPTSELNQ
DSQ  ATGTGGGATCCACTTACAAATGATTTTCCCGAAACCGTACACGGATTCAGGTGTATGCTTGCTATAAAATACTTGCAGTTGGTAGAAAATACGTATTCCCCCGATTCTTTGGGATACGATCTAATACGTGATTTAATTTCTGTCGTCAGGGCTAAAAGCTATGTCCAAGCGTCCGGCAGATATGATCATTTCCGGGCCCGTCTC......GAAGTATCGCCGACTTCTGAGCTCAATCAG
TRN  10010101110011010
NAM  O72714_9GEMI/1-78
ASQ  MWDPLVNEFPDTVHGFRCMHSVKYLQLLSQDYSPDTLGYELIRDLICILRSRNYVEASCRYRHFYARV..ESTPASELRQ
DSQ  ATGTGGGATCCACTAGTAAACGAATTCCCGGATACGGTGCACGGGTTTCGTTGTATGCATTCTGTCAAATATTTGCAACTTTTGTCGCAGGATTATTCTCCAGATACCCTTGGTTACGAGTTAATACGTGATTTAATCTGTATTCTACGCTCCCGTAATTATGTCGAAGCGAGCTGCCGATATCGTCATTTCTACGCCCGCGTC......GAAAGTACGCCGGCGTCTGAACTTCGGCAG
TRN  10010101110011010
NAM  Q992L9_9GEMI/4-81
ASQ  MWDPLLNEFPETVHGLRCMLAKKYVQEVQKTYSPDTIGYDLFCDLINLLNTKNYEQASSRYSHFYARL..QGTPPSELRH
DSQ  ATGTGGGATCCACTTTTGAATGAGTTTCCGGAGACTGTTCATGGTCTACGGTGTATGTTAGCTAAGAAATACGTACAGGAAGTTCAGAAGACGTATTCTCCGGATACGATTGGGTACGATTTGTTCTGTGATCTCATCAATCTTCTCAACACAAAAAATTATGAGCAAGCGTCCAGCAGATATAGTCATTTCTACGCCCGTCTC......CAAGGTACGCCGCCGTCTGAACTTCGACAC
TRN  10010101110011010
NAM  Q99DS0_9GEMI/1-78
ASQ  MWDPLVNDFPKSLHGFRCMLAIKYLQYIQENYPSNSLGYVYLTELIQVLRIRKHAKAELRYRLLYPDV..ECAEETDLRH
DSQ  ATGTGGGATCCATTGGTGAACGACTTTCCCAAATCGTTGCATGGTTTCCGTTGTATGCTTGCCATTAAGTATTTACAATACATTCAGGAGAATTATCCTTCTAATTCTCTTGGTTACGTGTATTTAACAGAGTTAATACAGGTTTTACGTATACGGAAACATGCCAAAGCGGAATTACGATACCGCCTTCTCTACCCCGATGTC......GAATGTGCGGAGGAGACTGACCTTCGACAC
TRN  10010101110011010
NAM  Q9WPL9_9GEMI/1-78
ASQ  MWDPLVHPFPESLHGFRCMLANQISSELNRKYSPDTVGHEFWKDFICIWRSKNYAEAFNRYSNVVANV..DNTSKAQLRE
DSQ  ATGTGGGATCCTCTGGTACATCCCTTTCCTGAAAGCTTACACGGCTTCAGATGTATGCTTGCCAATCAAATATCTTCAGAGCTTAACAGAAAATATTCTCCAGACACTGTTGGGCATGAGTTTTGGAAAGATTTTATATGCATATGGCGAAGTAAGAATTATGCCGAAGCGTTCAATAGATACAGTAACGTCGTTGCCAATGTC......GATAACACGTCGAAGGCTCAACTACGGGAG
TRN  10010101100011000
NAM  Q9QS59_9GEMI/4-83
ASQ  LWDPLQNPLPDTLYGFRCMLSVKYLQSILKKYEPGTLGFELCSELIRIFRVRQYDRANARFAEISSIWgeTGKTEAELRD
DSQ  TTGTGGGACCCTTTGCAGAACCCACTACCAGATACTTTATACGGTTTTAGGTGTATGCTATCCGTAAAATACTTGCAAAGTATTTTGAAGAAATACGAGCCAGGAACCTTAGGGTTCGAGCTCTGTTCGGAGTTAATCCGTATATTCAGAGTCAGGCAGTATGACAGGGCGAATGCGCGTTTCGCCGAGATTTCATCCATATGGggggagACCGGTAAGACGGAGGCTGAACTTCGAGAC
TRN  10010101110011000
NAM  O55375_9GEMI/1-77
ASQ  MFNPLTEPLPVTPHGLMCMLALKYLQEFEKSVHLTPCDNTELLLLRRVIRARTYDEAKRRYHIFHT-F..QGSKEVDVRH
DSQ  ATGTTTAACCCACTAACTGAACCCCTCCCAGTTACTCCTCACGGTTTGATGTGTATGTTGGCTTTGAAATATTTGCAGGAGTTCGAGAAATCTGTACATTTGACTCCGTGTGATAATACTGAGTTGTTGTTACTCCGCCGTGTTATTCGTGCAAGGACTTACGATGAAGCGAAGCGCCGATACCATATATTCCACACC---TTC......CAAGGCTCGAAGGAGGTTGACGTTCGACAC
TRN  10010101110011010
//