EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01503 - PRA-PH)
FAM  PF01503
PID  PRA-PH
DES  Phosphoribosyl-ATP pyrophosphohydrolase
IPR  IPR008179
ANO  17
ALN  97
AID  0.387229
APH  (((((((((HIS2_METJA/3-95:0.32129,HIS2_METTH/7-96:0.42085):0.25208,HIS2_SULSO/9-97:0.54374):0.07299,HIS2_AQUAE/117-205:0.62198):0.10341,((HIS2_RHOCA/4-92:0.32044,(HIS2_AZOBR/11-99:0.32596,(HIS2_ECOLI/115-203:0.20928,HIS2_HAEIN/122-210:0.34113):0.32312):0.13347):0.12636,HIS2_AZOCH/5-97:0.44498):0.19029):0.15099,(HIS2_LACLA/110-198:0.43628,HIS2_BACSU/117-205:0.30616):0.13147):0.12492,HIS2_SYNY3/127-215:0.63421):0.72332,(HIS2_NEUCR/300-384:0.28466,O59667_SCHPO/303-387:0.21825):0.08384):0.15218,HIS2_PICPA/290-374:0.24377):0.18659,HIS2_KLULA/241-325:0.12201,HIS2_SACBA/245-329:0.27598);
ATP  (((((((((HIS2_METJA/3-95,HIS2_METTH/7-96),HIS2_SULSO/9-97),HIS2_AQUAE/117-205),((HIS2_RHOCA/4-92,(HIS2_AZOBR/11-99,(HIS2_ECOLI/115-203,HIS2_HAEIN/122-210))),HIS2_AZOCH/5-97)),(HIS2_LACLA/110-198,HIS2_BACSU/117-205)),HIS2_SYNY3/127-215),(HIS2_NEUCR/300-384,O59667_SCHPO/303-387)),HIS2_PICPA/290-374),HIS2_KLULA/241-325,HIS2_SACBA/245-329);
ATL  8.93548
DNO  16
DLN  291
DID  0.457009
DPH  ((((((HIS2_LACLA/110-198:0.51849,HIS2_BACSU/117-205:0.20653):0.14447,((HIS2_ECOLI/115-203:0.22316,HIS2_HAEIN/122-210:0.43880):0.16453,((HIS2_AZOBR/11-99:0.21443,HIS2_RHOCA/4-92:0.23400):0.09353,HIS2_AZOCH/5-97:0.26195):0.16296):0.11036):0.15880,HIS2_AQUAE/117-205:0.33125):0.13963,(HIS2_SULSO/9-97:0.47606,(HIS2_METJA/3-95:0.21663,HIS2_METTH/7-96:0.41892):0.07424):0.10006):0.50705,(HIS2_PICPA/290-374:0.30804,(HIS2_NEUCR/300-384:0.36289,O59667_SCHPO/303-387:0.25806):0.19782):0.12246):0.04721,HIS2_KLULA/241-325:0.17909,HIS2_SACBA/245-329:0.22739);
DTP  ((((((HIS2_LACLA/110-198,HIS2_BACSU/117-205),((HIS2_ECOLI/115-203,HIS2_HAEIN/122-210),((HIS2_AZOBR/11-99,HIS2_RHOCA/4-92),HIS2_AZOCH/5-97))),HIS2_AQUAE/117-205),(HIS2_SULSO/9-97,(HIS2_METJA/3-95,HIS2_METTH/7-96))),(HIS2_PICPA/290-374,(HIS2_NEUCR/300-384,O59667_SCHPO/303-387))),HIS2_KLULA/241-325,HIS2_SACBA/245-329);
DTL  6.89881
RID  0.389539
RPH  (((((HIS2_LACLA/110-198:0.49296,HIS2_BACSU/117-205:0.26581):0.16478,((((HIS2_METJA/3-95:0.33147,HIS2_METTH/7-96:0.41700):0.25594,HIS2_SULSO/9-97:0.54881):0.07761,HIS2_AQUAE/117-205:0.61973):0.10897,(HIS2_AZOCH/5-97:0.44837,((HIS2_AZOBR/11-99:0.32006,(HIS2_ECOLI/115-203:0.20973,HIS2_HAEIN/122-210:0.34255):0.32949):0.13923,HIS2_RHOCA/4-92:0.31857):0.12175):0.17705):0.09145):0.84577,(HIS2_NEUCR/300-384:0.29126,O59667_SCHPO/303-387:0.21415):0.09641):0.14176,HIS2_PICPA/290-374:0.24660):0.18337,HIS2_KLULA/241-325:0.12033,HIS2_SACBA/245-329:0.27922);
RTP  (((((HIS2_LACLA/110-198,HIS2_BACSU/117-205),((((HIS2_METJA/3-95,HIS2_METTH/7-96),HIS2_SULSO/9-97),HIS2_AQUAE/117-205),(HIS2_AZOCH/5-97,((HIS2_AZOBR/11-99,(HIS2_ECOLI/115-203,HIS2_HAEIN/122-210)),HIS2_RHOCA/4-92)))),(HIS2_NEUCR/300-384,O59667_SCHPO/303-387)),HIS2_PICPA/290-374),HIS2_KLULA/241-325,HIS2_SACBA/245-329);
RTL  8.31555
LNK  HIS2_AQUAE/117-205:O67780:AE000765
LNK  HIS2_AZOBR/11-99:P26722:X61207
LNK  HIS2_AZOCH/5-97:Q43926:U48404
LNK  HIS2_BACSU/117-205:O34912:AF017113
LNK  HIS2_ECOLI/115-203:P06989:U02072
LNK  HIS2_HAEIN/122-210:P44434:U32730
LNK  HIS2_KLULA/241-325:O13471:Y09503
LNK  HIS2_LACLA/110-198:Q02130:AE006353
LNK  HIS2_METJA/3-95:Q57750:U67485
LNK  HIS2_METTH/7-96:O27344:AE000893
LNK  HIS2_NEUCR/300-384:P07685:AF045455
LNK  HIS2_PICPA/290-374:P45353:U14126
LNK  HIS2_RHOCA/4-92:O30723:AF016223
LNK  HIS2_SACBA/245-329:Q12670:U13062
LNK  HIS2_SULSO/9-97:O33776:AE006689
LNK  HIS2_SYNY3/127-215:P74755:
LNK  O59667_SCHPO/303-387:O59667:AL022299
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  O59667_SCHPO/303-387
ASQ  LCQLEKTLIDRKNNAPEGSYTARLFSD-----PKLLRAKIMEEAEELCDATTK--..---ENVIWEMADLMYFAITRCVGSGVSLNDISRHLDLKHR
DSQ  CTTTGTCAGTTAGAAAAGACTTTAATCGATAGGAAGAATAATGCTCCTGAGGGATCTTATACTGCTCGTTTGTTCTCCGAC---------------CCAAAGTTATTGCGTGCAAAAATTATGGAGGAAGCTGAAGAGTTGTGTGATGCTACCACCAAA------......---------GAGAATGTTATTTGGGAAATGGCTGATTTGATGTACTTTGCCATAACCCGCTGCGTCGGTTCGGGTGTTAGCCTTAATGACATTAGTCGTCATCTTGATTTGAAACATCGT
TRN  10010101110011010
NAM  HIS2_NEUCR/300-384
ASQ  LPKLEQTLISRKQSAPEGSYTARLFSD-----EKLVRAKIMEEAEELCTAQTP--..---QEIAFEAADLFYFALTRAVAAGVTLADIERSLDAKSW
DSQ  CTTCCCAAGCTCGAGCAGACTTTGATTTCGAGGAAACAGTCTGCCCCCGAGGGCTCCTACACTGCCCGTCTCTTCTCCGAT---------------GAGAAGCTAGTCCGGGCCAAGATCATGGAGGAGGCTGAGGAGCTCTGCACCGCTCAGACCCCC------......---------CAGGAAATCGCCTTTGAGGCTGCCGATCTCTTCTACTTTGCTCTTACCAGGGCCGTTGCTGCCGGCGTTACTCTTGCCGATATCGAAAGGAGCCTTGACGCCAAGAGCTGG
TRN  10010101110011011
NAM  HIS2_SACBA/245-329
ASQ  LVGLESLLKQRLQDAPKESYTRRLFND----P-ALLDAKIKEEAEELTEAKGK--..---QEISWEAADLFYFALAKLVTNNVSLKDVENNLNMKHL
DSQ  TTGGTCGGATTAGAGTCTTTACTAAAACAAAGATTACAAGACGCTCCAAAAGAATCTTATACTAGAAGGTTATTCAACGAT------------CCC---GCACTATTGGATGCCAAGATCAAAGAAGAAGCCGAAGAACTGACCGAGGCAAAGGGCAAA------......---------CAAGAAATATCTTGGGAAGCTGCCGACTTGTTTTACTTTGCATTGGCCAAATTAGTAACCAATAACGTTTCATTGAAGGATGTTGAAAATAATTTAAATATGAAGCACTTA
TRN  10010101100011000
NAM  HIS2_KLULA/241-325
ASQ  LYGLQKLLQERLLNAPEGSYTKRLFND----S-DLLTAKIKEEAEELTEAVDK--..---KDIAWECADLFYFAMARLVANGVSLEDVERNLNTKHL
DSQ  TTATACGGTCTACAGAAGCTTTTACAGGAAAGACTCCTTAATGCCCCAGAAGGATCATACACCAAAAGACTATTCAATGAT------------TCG---GACCTTTTAACTGCCAAGATCAAAGAAGAAGCAGAAGAACTTACCGAAGCTGTTGATAAA------......---------AAAGATATAGCTTGGGAATGTGCTGATTTATTTTACTTTGCTATGGCTAGGCTAGTTGCCAATGGCGTATCATTAGAGGATGTTGAGCGTAACCTAAATACCAAACACTTG
TRN  10010101110011000
NAM  HIS2_PICPA/290-374
ASQ  LRAMEATLWDRKSNAPEGSYTKRLFDD----E-VLLNAKIREEADELAEAKSK--..---EDIAWECADLFYFALVRCAKYGVTLDEVERNLDMKSL
DSQ  CTTAGAGCCATGGAAGCCACCTTGTGGGATCGTAAGAGCAATGCTCCAGAAGGTTCTTATACCAAACGGTTATTTGACGAC------------GAA---GTTTTGTTGAACGCTAAAATTAGGGAGGAAGCTGATGAACTTGCAGAAGCTAAATCCAAG------......---------GAAGATATAGCCTGGGAATGTGCTGACTTATTTTATTTTGCATTAGTTAGATGTGCCAAGTACGGCGTGACGTTGGACGAGGTGGAGAGAAACCTGGATATGAAGTCCCTA
TRN  10010101100011010
NAM  HIS2_METTH/7-96
ASQ  LREVYRVLEDR-RDRPIDSYTSRLMRDDDKMAEDKILEKIGEEAAEVIIASKND-..---ENLVEEAADLIFHTLLLLVYKGVPLDSLLEEFAARRK
DSQ  TTAAGGGAAGTATACCGTGTGCTTGAGGATCGG---AGGGACAGACCCATTGATTCATACACTTCACGCCTCATGAGGGATGATGATAAAATGGCAGAGGATAAGATCCTTGAGAAAATAGGGGAGGAGGCCGCAGAGGTCATAATAGCATCAAAGAATGAT---......---------GAGAACCTCGTGGAGGAGGCAGCCGACCTCATATTCCACACTCTGCTCCTGCTGGTATACAAGGGCGTGCCCCTTGACAGCCTCCTGGAGGAGTTTGCTGCAAGAAGAAAA
TRN  10010101100011000
NAM  HIS2_METJA/3-95
ASQ  LEEVYEIIKQRIKEKPEGSYVAKLTTDDKKTAINKICEKIGEESTELILAAKDDK..--KDEIIYEAADLIFHTMVLLAYKNIEFEELLKEFERRKK
DSQ  TTAGAGGAAGTTTATGAAATTATAAAACAAAGAATAAAAGAAAAGCCAGAAGGTTCTTATGTGGCAAAACTAACAACCGATGATAAAAAAACGGCAATAAACAAAATCTGTGAGAAAATTGGGGAGGAATCTACTGAATTAATTTTAGCAGCTAAGGATGACAAG......------AAAGATGAGATTATTTATGAGGCTGCTGATTTAATATTCCATACTATGGTATTATTGGCTTATAAGAACATAGAGTTTGAAGAATTATTAAAGGAATTTGAAAGAAGAAAGAAA
TRN  10010101110011010
NAM  HIS2_SYNY3/127-215
ASQ  LTELARVIGDRRDHPTPESYTCKLLAG----GDNKILKKIGEESAEVVMACKD--..DDPEAIAGEVADLFYHTLVALAHHNVDLRAVYRKLGDRRR
NAM  HIS2_BACSU/117-205
ASQ  MNELERVIAERQAEMPEGAYTTYLFRE----GVDKILKKVGEEASEVIIAAKN--..RDHEELKWEAADLLYHLLVLLREQSLPLDDVLDVLKKRHS
DSQ  ATGAACGAACTGGAGCGGGTGATCGCGGAACGCCAAGCGGAAATGCCTGAAGGAGCTTACACCACGTACCTCTTCCGTGAA------------GGCGTCGATAAGATTTTGAAAAAAGTCGGAGAAGAAGCATCCGAAGTCATCATCGCCGCGAAAAAC------......CGGGATCATGAGGAACTCAAATGGGAAGCGGCAGACCTGCTGTATCACCTGCTTGTCCTGCTCAGAGAACAATCCCTGCCGCTGGATGATGTGCTTGACGTATTGAAAAAACGCCATTCT
TRN  10010101100011011
NAM  HIS2_LACLA/110-198
ASQ  FSELEKQIIDRKLHPVEKSYTNYLLGE----GIDKVLKKVGEEASEVIIASKN--..SDKGELLGEIDDLLYHLFVLMNQQGISLEEVRQKAKERHQ
DSQ  TTTAGTGAGTTGGAGAAGCAAATCATCGACCGAAAGTTACATCCAGTCGAAAAATCTTATACGAATTATTTGCTTGGAGAG------------GGCATTGATAAAGTATTAAAAAAAGTTGGTGAAGAAGCAAGTGAAGTGATTATTGCTAGTAAAAAT------......TCAGATAAAGGAGAACTTTTAGGAGAAATTGATGATTTACTTTATCATTTGTTTGTATTAATGAATCAGCAAGGTATTTCTCTAGAAGAAGTACGGCAAAAAGCAAAAGAACGGCATCAG
TRN  11011101111011000
NAM  HIS2_AZOCH/5-97
ASQ  LNQLAEVLEARKNAAPDSSYVASLYHK----GLNKILEKVGEESVETILAAKDAAasGDCSELIYETADLWFHSLVMLAALGQHPQAVLDELERRFG
DSQ  CTCAACCAGCTGGCCGAAGTGCTAGAGGCGCGCAAGAACGCCGCCCCGGACAGCTCCTACGTGGCCAGCCTGTACCACAAG------------GGCCTGAACAAGATCCTCGAGAAGGTCGGCGAGGAATCGGTGGAAACCATCCTCGCCGCCAAGGACGCCGCCgccagcGGCGACTGCAGCGAGCTGATCTACGAGACCGCCGACCTCTGGTTCCACAGCCTGGTCATGCTCGCCGCCCTCGGCCAGCATCCCCAGGCCGTGCTCGACGAACTGGAGCGGCGCTTCGGC
TRN  11011111101111111
NAM  HIS2_RHOCA/4-92
ASQ  LSRLAATVEARKGADPESSWTAKLFAK----GPEKCAEKFGEEAVEAIIAAVK--..NDRANLVYEAADVLYHLTVMLAARDVSLDEVLAELDRRAG
DSQ  CTGTCCCGCCTGGCCGCCACCGTCGAAGCCCGCAAGGGCGCCGATCCCGAAAGTTCCTGGACCGCGAAGCTTTTCGCCAAG------------GGCCCGGAAAAATGCGCCGAGAAATTCGGCGAGGAAGCGGTCGAGGCGATCATCGCCGCGGTGAAG------......AACGACCGTGCGAACCTTGTTTATGAAGCCGCCGACGTGCTTTACCATCTGACCGTGATGCTGGCCGCGCGCGACGTGAGCCTGGACGAGGTTCTGGCCGAGCTGGACCGCCGCGCGGGC
TRN  11011101101011011
NAM  HIS2_AZOBR/11-99
ASQ  LDRLYATVQARKGADPETSYTAKLFHR----GTAKIAQKVGEEAVETVIEAVR--..GDKAAMASESADLLYHLMVLWADAGLEPAAVWEKLAQREG
DSQ  CTGGACCGGCTCTACGCCACCGTCCAGGCGCGCAAGGGGGCCGATCCGGAGACCTCCTACACCGCCAAGCTGTTCCACCGC------------GGCACCGCCAAGATCGCCCAGAAGGTCGGCGAGGAAGCGGTGGAGACGGTCATCGAGGCGGTGCGC------......GGCGACAAGGCGGCCATGGCCTCGGAATCGGCGGACCTGCTCTATCACCTGATGGTGCTGTGGGCCGACGCCGGGCTGGAGCCCGCCGCGGTGTGGGAGAAGCTGGCCCAGCGCGAGGGC
TRN  11011111101111111
NAM  HIS2_HAEIN/122-210
ASQ  FIKLEQHLKEKKNADPSNSYTATLHAK----GTKKIAQKVGEEGVETALAAVA--..QDKAEVISEATDLVYHLTVLLHNQDLQWYEIIAKLQERHQ
DSQ  TTTATAAAATTAGAACAACATTTAAAAGAAAAGAAAAATGCAGATCCTTCTAATTCTTATACTGCAACATTACACGCAAAA------------GGTACCAAAAAAATCGCCCAAAAAGTGGGGGAAGAAGGTGTGGAAACTGCCTTGGCTGCGGTCGCA------......CAAGATAAAGCGGAAGTCATTTCTGAAGCTACAGATTTGGTCTATCACTTAACCGTATTATTACACAATCAAGATCTTCAGTGGTACGAAATTATCGCAAAACTACAAGAACGCCATCAA
TRN  10010101110011010
NAM  HIS2_ECOLI/115-203
ASQ  LYQLEQLLAERKSADPETSYTAKLYAS----GTKRIAQKVGEEGVETALAATV--..HDRFELTNEASDLMYHLLVLLQDQGLDLTTVIENLRKRHQ
DSQ  CTGTATCAACTGGAACAACTGCTCGCCGAGCGCAAATCTGCCGATCCGGAAACCTCCTACACCGCCAAACTGTATGCCAGC------------GGCACCAAACGCATTGCGCAGAAAGTGGGTGAAGAAGGCGTGGAAACCGCGCTGGCAGCAACGGTA------......CATGACCGCTTTGAGCTGACCAACGAGGCGTCTGATTTGATGTATCACCTGCTGGTGTTGTTGCAGGATCAGGGGCTGGATTTAACGACGGTAATTGAGAACCTGCGTAAACGGCATCAG
TRN  11011101101011010
NAM  HIS2_SULSO/9-97
ASQ  VDELYKIILDRIEKRPTGSYTAEIVNK----GKPYVARKVGEESVETIVASLAE-..-NKERFISEVADLIYHLLVLMALEGVTPEDIYRELERRRK
DSQ  GTAGATGAATTATACAAAATCATACTTGATAGGATAGAAAAGAGGCCGACTGGTAGTTACACTGCTGAGATTGTAAATAAG------------GGAAAACCATACGTAGCGAGGAAGGTTGGCGAAGAATCTGTAGAAACAATAGTAGCATCTCTAGCAGAA---......---AATAAGGAGAGATTTATAAGTGAGGTCGCTGATCTAATCTATCATTTATTAGTATTAATGGCATTAGAAGGCGTAACACCAGAGGATATTTATAGAGAGTTAGAGAGGAGGAGAAAA
TRN  10010101110011010
NAM  HIS2_AQUAE/117-205
ASQ  LPRLQDVIREKIERKEENSYTAKLVSQ----GKERVFQKFGEEAVETLIALMK--..GEKEEVIYESADMLYTFLVSLSVSGIDIKEVMEELIRRFK
DSQ  CTTCCCAGATTACAGGACGTGATAAGGGAAAAAATAGAAAGAAAGGAAGAAAACTCTTACACTGCAAAGTTGGTAAGCCAA------------GGGAAGGAAAGAGTGTTCCAGAAGTTCGGAGAAGAAGCCGTGGAAACCCTGATAGCCTTAATGAAA------......GGAGAAAAGGAAGAGGTGATATACGAGAGTGCGGATATGCTGTACACCTTTCTCGTATCCCTGAGCGTAAGCGGGATAGACATAAAGGAGGTGATGGAGGAACTCATAAGACGCTTTAAG
TRN  10010101100011010
//