EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01470 - Peptidase_C15)
FAM  PF01470
PID  Peptidase_C15
DES  Pyroglutamyl peptidase
IPR  IPR000816
ANO  9
ALN  212
AID  0.423949
APH  (PCP_THELI/2-209:0.33116,PCP_PYRHO/1-200:0.32513,((PCP_MYCTU/2-209:0.68319,((((PCP_LACLC/1-202:0.33446,PCP_STRPY/1-202:0.27515):0.13505,PCP_STAAU/1-202:0.46318):0.14057,PCP_BACSU/3-204:0.41938):0.16353,PCP_PSEFL/2-202:0.43466):0.10783):0.30078,PCP_PYRFU/1-207:0.28431):0.09323);
ATP  (PCP_THELI/2-209,PCP_PYRHO/1-200,((PCP_MYCTU/2-209,((((PCP_LACLC/1-202,PCP_STRPY/1-202),PCP_STAAU/1-202),PCP_BACSU/3-204),PCP_PSEFL/2-202)),PCP_PYRFU/1-207));
ATL  4.49161
DNO  9
DLN  636
DID  0.492855
DPH  ((PCP_THELI/2-209:0.30393,((((PCP_LACLC/1-202:0.30194,PCP_STRPY/1-202:0.25206):0.08856,PCP_STAAU/1-202:0.33037):0.15145,PCP_BACSU/3-204:0.37647):0.12241,(PCP_MYCTU/2-209:0.50672,PCP_PSEFL/2-202:0.34195):0.10746):0.23722):0.08699,PCP_PYRHO/1-200:0.30896,PCP_PYRFU/1-207:0.26987);
DTP  ((PCP_THELI/2-209,((((PCP_LACLC/1-202,PCP_STRPY/1-202),PCP_STAAU/1-202),PCP_BACSU/3-204),(PCP_MYCTU/2-209,PCP_PSEFL/2-202))),PCP_PYRHO/1-200,PCP_PYRFU/1-207);
DTL  3.78636
RID  0.423949
RPH  (PCP_THELI/2-209:0.33116,PCP_PYRHO/1-200:0.32513,((PCP_MYCTU/2-209:0.68319,((((PCP_LACLC/1-202:0.33446,PCP_STRPY/1-202:0.27515):0.13505,PCP_STAAU/1-202:0.46318):0.14057,PCP_BACSU/3-204:0.41938):0.16353,PCP_PSEFL/2-202:0.43466):0.10783):0.30078,PCP_PYRFU/1-207:0.28431):0.09323);
RTP  (PCP_THELI/2-209,PCP_PYRHO/1-200,((PCP_MYCTU/2-209,((((PCP_LACLC/1-202,PCP_STRPY/1-202),PCP_STAAU/1-202),PCP_BACSU/3-204),PCP_PSEFL/2-202)),PCP_PYRFU/1-207));
RTL  4.49161
LNK  PCP_BACSU/3-204:P28618:X66034
LNK  PCP_LACLC/1-202:O87765:AJ223960
LNK  PCP_MYCTU/2-209:O07930:BX842573
LNK  PCP_PSEFL/2-202:P42673:X75919
LNK  PCP_PYRFU/1-207:O73944:AB015291
LNK  PCP_PYRHO/1-200:O58321:AP000002
LNK  PCP_STAAU/1-202:Q53596:U19770
LNK  PCP_STRPY/1-202:P68896:A25845
LNK  PCP_THELI/2-209:O07883:Y13966
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  PCP_PSEFL/2-202
ASQ  RIVLLTGFEPFDQDPVNPSWEAVRQLDGVQLGSDVKIVARRLPCAFATAGECLTRLIDELHPAMVIATGLGPGRSDISVERVAININDA-R--IPDNLGEQPIDTAVVADGPAAFFTTLPIKAMVKAVREAGIAASVSQTAGTFVCNQVFYLLQHALAGSG--VRSGFIHVPFLPEQVAGSQ-R-----PSMALDAMVAGLQAAVLTAWHTP
DSQ  CGAATTGTACTGCTGACGGGTTTCGAACCCTTTGATCAAGACCCGGTGAACCCCTCCTGGGAAGCTGTGCGCCAACTGGATGGCGTGCAGTTGGGAAGCGACGTGAAGATTGTTGCGCGCCGGCTGCCTTGTGCATTTGCCACGGCGGGTGAATGCCTGACCCGGCTGATCGACGAGTTGCACCCGGCGATGGTGATCGCCACCGGATTGGGGCCGGGGCGTAGCGATATCTCAGTCGAACGGGTGGCGATCAACATCAATGATGCA---CGC------ATCCCCGATAATCTGGGTGAGCAGCCTATCGATACGGCAGTCGTGGCTGACGGCCCGGCGGCTTTTTTCACGACGCTGCCGATCAAGGCGATGGTCAAGGCCGTGCGTGAAGCGGGAATCGCGGCCTCGGTATCGCAGACGGCAGGGACGTTCGTGTGTAATCAGGTTTTTTATCTGCTGCAGCATGCGCTCGCAGGGTCTGGG------GTACGCAGTGGGTTTATCCACGTGCCGTTTCTGCCGGAGCAGGTGGCGGGTTCGCAG---CGG---------------CCCTCGATGGCACTGGATGCAATGGTTGCGGGATTGCAGGCGGCTGTACTGACAGCTTGGCATACACCG
TRN  11011111101111101
NAM  PCP_BACSU/3-204
ASQ  KKVLITGFDPFDKETVNPSWEAAKRLNG-FETEEAIITAEQIPTVFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADA-R--IPDNEGHQPIDEEISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIRGGFIHIPYIPQQTIDKT-A-----PSLSLDTIVRALRIAAVTAAQYD
DSQ  AAAAAAGTGCTGATCACAGGCTTTGACCCTTTTGACAAAGAAACCGTCAATCCATCATGGGAAGCGGCGAAACGGCTTAATGGC---TTCGAGACAGAAGAAGCCATTATTACAGCGGAACAAATTCCAACCGTCTTTAGATCCGCTCTGGACACTCTGCGCCAAGCCATTCAAAAACATCAGCCAGATATCGTAATTTGTGTCGGCCAAGCAGGAGGACGGATGCAGATTACACCGGAACGAGTGGCAATCAACCTTGCAGATGCG---CGA------ATCCCCGATAACGAAGGACATCAGCCGATTGATGAAGAGATTTCTCCAGATGGGCCCGCCGCTTACTGGACAAGGCTTCCCGTGAAACGAATGACTGCTAAGATGAAGGAACACGGCATTCCAGCTGCGGTTTCCTACACAGCGGGGACCTTTGTATGCAACTATTTGTTCTACGGGTTAATGGATCACATTAGCCGGACATCCCCACACATTCGCGGCGGTTTTATTCATATTCCTTACATTCCGCAGCAAACAATCGACAAAACA---GCG---------------CCGAGCCTCAGCCTGGACACGATTGTCCGGGCATTGAGAATCGCCGCTGTTACGGCCGCACAATATGAT
TRN  10010101100011000
NAM  PCP_STAAU/1-202
ASQ  MHILVTGFAPFDNQDINPSWEAVTQLE--NIIGTHTIDKLKLPTSFKKVDTIINKTLASNHYDVVLAIGQAGGRNAITPERVAINIDDA-R--IPDNDDFQPIDQAIHLDGAPRYFSNLPVKAMTQSVINQGLPGALSNSAGTFVCNHVLYHLGYLQDKHYPHLRFGFIHVPYIPEQVVGKSDT-----PSMPLEQIVAGLTAAIEAISDHD
DSQ  ATGCACATTTTAGTAACAGGGTTCGCGCCTTTTGACAATCAAGATATTAATCCTTCTTGGGAAGCTGTGACTCAACTAGAA------AATATTATTGGCACACATACAATCGATAAATTAAAACTACCAACCTCTTTTAAGAAAGTAGATACTATTATAAATAAAACGTTGGCATCTAATCATTATGATGTTGTACTAGCTATAGGACAAGCTGGTGGTAGAAATGCCATTACCCCAGAACGTGTCGCCATTAATATTGATGATGCA---CGT------ATTCCAGATAATGATGATTTTCAACCTATTGATCAAGCCATTCATTTAGACGGTGCGCCACGTTATTTTTCAAATTTACCAGTTAAAGCAATGACTCAAAGTGTTATTAACCAAGGACTTCCTGGAGCACTTTCAAATAGCGCAGGTACGTTCGTATGTAATCACGTACTTTATCACTTAGGTTATTTACAAGATAAGCATTACCCTCACCTTCGATTCGGATTTATTCATGTGCCATATATACCAGAGCAAGTCGTTGGTAAATCCGATACA---------------CCATCTATGCCATTAGAACAGATAGTTGCAGGTTTGACTGCAGCCATTGAAGCTATTTCTGATCACGAT
TRN  10010101110011000
NAM  PCP_STRPY/1-202
ASQ  MKILVTGFDPFGGEAINPALEAIKKLP--ATIHGAEIKCIEVPTVFQKSADVLQQHIESFQPDAVLCIGQAGGRTGLTPERVAINQDDA-R--IPDNEGNQPIDTPIRADGKAAYFSTLPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKYCPNAKAGFMHIPFMMEQVVDKPNT-----AAMNLDDITRGIEAAIFAIVDFK
DSQ  ATGAAAATTCTTGTAACAGGCTTTGATCCCTTTGGCGGCGAAGCTATTAATCCTGCCCTTGAAGCTATCAAGAAATTGCCA------GCAACCATTCATGGAGCAGAAATCAAATGTATTGAAGTTCCAACGGTTTTTCAAAAATCTGCCGATGTGCTCCAGCAGCATATCGAAAGCTTTCAACCTGATGCAGTCCTTTGTATTGGGCAAGCTGGTGGCCGGACTGGACTAACGCCAGAACGCGTTGCCATTAATCAAGACGATGCT---CGC------ATTCCTGATAACGAAGGGAATCAGCCTATTGATACACCTATTCGTGCAGATGGTAAAGCAGCTTATTTTTCAACCTTGCCAATCAAAGCGATGGTTGCTGCCATTCATCAGGCTGGGCTTCCTGCTTCTGTTTCTAATACAGCTGGTACCTTTGTTTGCAATCATTTGATGTATCAAGCCCTTTACTTAGTGGATAAATATTGTCCAAATGCCAAAGCTGGGTTTATGCATATTCCCTTTATGATGGAACAGGTTGTTGATAAACCTAATACA---------------GCTGCCATGAACCTCGATGATATTACAAGAGGAATTGAGGCTGCTATTTTTGCCATTGTCGATTTCAAA
TRN  10010101110011000
NAM  PCP_LACLC/1-202
ASQ  MKILVTGFDPFGDDKINPAIEAVKRLP--DEIAGAQIVKLEIPTKFNVSADVVKDAIAKEKPDYVLSIGQAGGRFELTPERVAINLDDG-R--IQDNAGYQPLNHTIHGDDENAYFTQLPIKAMAKAIREAGVPSAVSNTAGTYVCNHIFYQVQYMRDKMFPDIKAGFMHIPFLPEQVVTRPET-----PALSLDDDVLGITAAIKAIVSRD
DSQ  ATGAAAATTCTTGTTACCGGATTTGATCCCTTTGGCGACGATAAAATTAATCCTGCGATTGAAGCCGTGAAACGTTTGCCG------GATGAAATTGCTGGGGCACAAATCGTTAAATTGGAAATTCCGACAAAGTTTAATGTTTCAGCCGATGTCGTTAAAGATGCTATTGCCAAAGAAAAGCCTGACTATGTGTTGAGCATTGGTCAGGCTGGTGGCCGGTTTGAACTCACGCCGGAGCGAGTTGCGATTAACTTGGATGACGGT---CGG------ATTCAAGATAATGCCGGGTATCAGCCACTTAATCACACGATTCATGGCGATGACGAGAATGCCTACTTTACCCAGTTACCAATTAAGGCCATGGCCAAAGCCATTCGGGAAGCTGGTGTTCCGTCAGCAGTCTCCAACACAGCAGGCACTTACGTCTGCAACCACATTTTTTATCAGGTACAGTATATGCGGGATAAGATGTTTCCCGATATTAAGGCCGGCTTCATGCATATTCCATTTTTGCCGGAACAGGTTGTCACTCGTCCGGAAACA---------------CCAGCGTTGTCATTGGATGATGATGTTTTAGGCATCACTGCCGCTATCAAGGCCATCGTGTCCCGTGAC
TRN  11011101111011000
NAM  PCP_PYRFU/1-207
ASQ  MKVLVTGFEPFGGEKINPTERIAKDLDG-IKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDA-R--IPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGK-GQVPPSMCYEMELEAVKVAIEVALEEL
DSQ  ATGAAAGTATTAGTTACCGGGTTTGAGCCGTTTGGAGGAGAGAAAATTAACCCCACCGAAAGAATAGCAAAGGATCTTGACGGG---ATTAAGATTGGAGATGCCCAAGTATTTGGGAGAGTCCTCCCAGTGGTCTTTGGGAAAGCCAAGGAAGTATTGGAGAAAACATTAGAGGAGATAAAGCCAGACATAGCAATTCATGTGGGATTGGCCCCAGGAAGGAGCGCAATAAGTATAGAGAGGATAGCCGTCAATGCTATTGACGCT---AGA------ATTCCGGATAATGAAGGGAAGAAGATTGAGGACGAGCCAATAGTCCCAGGAGCCCCAACGGCGTATTTCTCTACACTTCCAATAAAGAAGATCATGAAGAAGTTACACGAAAGAGGAATTCCCGCTTACATCTCAAACTCCGCTGGACTTTATCTCTGCAACTACGTTATGTACCTAAGCCTCCATCACTCAGCGACTAAAGGATATCCAAAGATGAGCGGATTTATACACGTCCCTTACATCCCAGAGCAGATCATAGATAAGATAGGGAAG---GGCCAAGTGCCTCCAAGCATGTGCTATGAGATGGAGCTTGAAGCTGTTAAAGTAGCCATAGAGGTTGCGCTCGAGGAGTTG
TRN  10010101110011000
NAM  PCP_THELI/2-209
ASQ  KKVLITGFEPFGGDSKNPTEQIAKYFDR-KQIGNAMVYGRVLPVSVKRATIELKRYLEEIKPEIVINLGLAPTYSNITVERIAVNIIDA-R--IPDNDGYQPIDEKIEEDAPLAYMATLPVRAITKTLRDNGIPATISYSAGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPYTPDQVVNKFFLLGKNTPSMCLEAEIKAIELAVKVSLDYL
DSQ  AAAAAAGTATTGATAACAGGATTTGAACCATTTGGTGGGGATAGCAAAAACCCAACCGAACAAATTGCTAAATATTTTGACAGA---AAACAAATCGGCAATGCAATGGTTTATGGAAGAGTTTTGCCAGTATCTGTAAAACGGGCCACTATTGAGCTAAAGAGATATTTAGAAGAAATAAAACCGGAAATAGTGATTAATTTAGGATTGGCCCCAACATATAGCAATATTACAGTAGAAAGAATAGCTGTAAACATCATTGATGCT---CGA------ATCCCAGATAATGATGGGTATCAGCCTATAGATGAGAAAATTGAAGAAGACGCACCTCTTGCATATATGGCCACACTTCCAGTTAGAGCCATTACAAAGACACTCAGGGATAATGGTATTCCAGCTACAATTTCATATAGTGCCGGCACGTATCTTTGCAATTACGTGATGTTCAAGACATTACACTTCTCAAAAATTGAAGGATATCCACTTAAAGCAGGATTCATTCATGTCCCATACACTCCAGATCAGGTTGTTAATAAATTTTTCCTTTTAGGAAAAAATACCCCCAGTATGTGTCTAGAAGCTGAAATAAAGGCAATAGAACTGGCGGTGAAAGTTAGTCTAGACTATTTA
TRN  10010101100011000
NAM  PCP_PYRHO/1-200
ASQ  MKILLTGFEPFGGDDKNPTMDIVEALSE-R-IP--EVVGEILPVSFKRAREKLLKVLDDVRPDITINLGLAPGRTHISVERVAVNMIDA-R--IPDNDGEQPKDEPIVEGGPAAYFATIPTREIVEEMKKNGIPAVLSYTAGTYLCNFAMYLTLHTSATKGYPKIAGFIHVPYTPDQVLEKKNT-----PSMSLDLEIKGVEIAIRVAQSAL
DSQ  ATGAAGATCTTATTGACTGGCTTTGAGCCCTTTGGAGGTGACGATAAGAATCCCACTATGGATATAGTTGAAGCTCTAAGCGAA---AGG---ATACCT------GAGGTCGTTGGGGAGATACTACCCGTATCCTTCAAGAGGGCTAGAGAAAAGCTCCTCAAGGTACTTGACGATGTTAGGCCAGATATAACCATAAACCTGGGCTTGGCCCCAGGAAGAACGCACATATCCGTTGAGAGAGTAGCCGTGAACATGATAGATGCG---AGG------ATTCCGGATAATGATGGAGAGCAACCGAAGGATGAACCCATAGTCGAGGGAGGACCTGCAGCTTATTTTGCAACAATACCCACTAGGGAGATAGTCGAAGAGATGAAGAAGAACGGCATTCCAGCGGTTCTCTCTTACACGGCTGGAACTTATCTCTGCAATTTCGCCATGTATTTAACCTTACACACATCAGCTACCAAGGGATATCCCAAGATTGCTGGCTTCATACACGTTCCCTACACTCCGGATCAAGTCCTGGAGAAAAAGAATACT---------------CCGAGCATGTCTCTAGATTTAGAAATAAAGGGAGTGGAGATAGCAATAAGGGTTGCTCAGAGCGCGCTA
TRN  10010101100011000
NAM  PCP_MYCTU/2-209
ASQ  SKVLVTGFGPYGVTPVNPAQLTAEELDG-RTIAGATVISRIVPNTFFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLPVRAGWIHLPCLPSVAALDHNLG---VPSMSVQTAVAGVTAGIEAAIRQS
DSQ  TCGAAGGTGCTGGTCACCGGATTCGGACCCTACGGCGTGACGCCGGTAAATCCGGCACAGCTCACCGCCGAAGAGCTGGATGGT---CGCACCATCGCCGGCGCAACGGTCATCTCGCGGATCGTGCCCAACACGTTCTTCGAGTCGATCGCGGCAGCTCAGCAGGCCATCGCAGAGATCGAGCCAGCATTGGTGATCATGCTGGGCGAATACCCGGGACGCAGCATGATCACCGTCGAGCGACTCGCGCAAAACGTCAACGACTGCGGGCGGTACGGCCTCGCCGACTGCGCCGGCAGGGTTTTGGTCGGTGAGCCAACCGACCCCGCCGGCCCGGTCGCCTACCACGCGACCGTACCGGTTCGCGCGATGGTGCTGGCCATGCGAAAGGCCGGCGTGCCAGCTGACGTCTCGGACGCGGCGGGCACGTTCGTGTGCAATCACCTCATGTACGGCGTGCTGCACCACCTCGCCCAGAAGGGTCTGCCCGTCCGCGCCGGTTGGATTCATCTGCCGTGCCTGCCCAGCGTCGCCGCACTGGATCACAACCTCGGT---------GTTCCGAGCATGTCGGTCCAGACGGCGGTCGCCGGGGTCACGGCTGGCATCGAGGCAGCCATTCGGCAGTCC
TRN  10010101100011011
//