EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01466 - Skp1)
FAM  PF01466
PID  Skp1
DES  Skp1 family, dimerisation domain
IPR  IPR001232
ANO  16
ALN  86
AID  0.450908
APH  ((Q92229_EMENI/83-160:0.05382,CBF3D_YEAST/115-192:0.23253):0.10999,((((O81055_ARATH/89-167:0.14722,O81058_ARATH/112-190:0.23591):0.12010,O81057_ARATH/71-149:0.11117):0.17180,Q39255_ARATH/83-160:0.04893):0.17936,((Q93731_CAEEL/97-174:0.20200,O45517_CAEEL/90-167:0.24737):0.09309,SKP1_HUMAN/84-161:0.03940):0.05318):0.05587,(((Q21968_CAEEL/88-155:1.21044,((Q22871_CAEEL/96-170:0.29370,O45357_CAEEL/105-189:0.45210):0.08407,Q17696_CAEEL/107-180:0.63244):0.18967):0.00000,(Q21969_CAEEL/89-165:0.72100,Q21367_CAEEL/80-161:1.27351):0.14664):0.12331,Q89374_CHVP1/68-145:0.66851):0.13358);
ATP  ((Q92229_EMENI/83-160,CBF3D_YEAST/115-192),((((O81055_ARATH/89-167,O81058_ARATH/112-190),O81057_ARATH/71-149),Q39255_ARATH/83-160),((Q93731_CAEEL/97-174,O45517_CAEEL/90-167),SKP1_HUMAN/84-161)),(((Q21968_CAEEL/88-155,((Q22871_CAEEL/96-170,O45357_CAEEL/105-189),Q17696_CAEEL/107-180)),(Q21969_CAEEL/89-165,Q21367_CAEEL/80-161)),Q89374_CHVP1/68-145));
ATL  8.03071
DNO  16
DLN  258
DID  0.531298
DPH  ((((((SKP1_HUMAN/84-161:0.13452,(Q93731_CAEEL/97-174:0.11777,O45517_CAEEL/90-167:0.34398):0.09508):0.06259,((((O81055_ARATH/89-167:0.08285,O81058_ARATH/112-190:0.11997):0.09180,O81057_ARATH/71-149:0.06249):0.05116,Q89374_CHVP1/68-145:0.47191):0.10132,Q39255_ARATH/83-160:0.13419):0.12967):0.02860,(Q92229_EMENI/83-160:0.13321,CBF3D_YEAST/115-192:0.26289):0.07849):0.21484,(Q21968_CAEEL/88-155:0.57668,(Q17696_CAEEL/107-180:0.36671,Q21367_CAEEL/80-161:0.65102):0.09868):0.10751):0.11397,Q21969_CAEEL/89-165:0.47889):0.09933,Q22871_CAEEL/96-170:0.17959,O45357_CAEEL/105-189:0.35992);
DTP  ((((((SKP1_HUMAN/84-161,(Q93731_CAEEL/97-174,O45517_CAEEL/90-167)),((((O81055_ARATH/89-167,O81058_ARATH/112-190),O81057_ARATH/71-149),Q89374_CHVP1/68-145),Q39255_ARATH/83-160)),(Q92229_EMENI/83-160,CBF3D_YEAST/115-192)),(Q21968_CAEEL/88-155,(Q17696_CAEEL/107-180,Q21367_CAEEL/80-161))),Q21969_CAEEL/89-165),Q22871_CAEEL/96-170,O45357_CAEEL/105-189);
DTL  5.74963
RID  0.450908
RPH  ((Q92229_EMENI/83-160:0.05382,CBF3D_YEAST/115-192:0.23253):0.10999,((((O81055_ARATH/89-167:0.14722,O81058_ARATH/112-190:0.23591):0.12010,O81057_ARATH/71-149:0.11117):0.17180,Q39255_ARATH/83-160:0.04893):0.17936,((Q93731_CAEEL/97-174:0.20200,O45517_CAEEL/90-167:0.24737):0.09309,SKP1_HUMAN/84-161:0.03940):0.05318):0.05587,(((Q21968_CAEEL/88-155:1.21044,((Q22871_CAEEL/96-170:0.29370,O45357_CAEEL/105-189:0.45210):0.08407,Q17696_CAEEL/107-180:0.63244):0.18967):0.00000,(Q21969_CAEEL/89-165:0.72100,Q21367_CAEEL/80-161:1.27351):0.14664):0.12331,Q89374_CHVP1/68-145:0.66851):0.13358);
RTP  ((Q92229_EMENI/83-160,CBF3D_YEAST/115-192),((((O81055_ARATH/89-167,O81058_ARATH/112-190),O81057_ARATH/71-149),Q39255_ARATH/83-160),((Q93731_CAEEL/97-174,O45517_CAEEL/90-167),SKP1_HUMAN/84-161)),(((Q21968_CAEEL/88-155,((Q22871_CAEEL/96-170,O45357_CAEEL/105-189),Q17696_CAEEL/107-180)),(Q21969_CAEEL/89-165,Q21367_CAEEL/80-161)),Q89374_CHVP1/68-145));
RTL  8.03071
LNK  CBF3D_YEAST/115-192:P52286:U43179
LNK  O45357_CAEEL/105-189:O45357:Z93377
LNK  O45517_CAEEL/90-167:O45517:Z83109
LNK  O81055_ARATH/89-167:O81055:AC005313
LNK  O81057_ARATH/71-149:O81057:AC005313
LNK  O81058_ARATH/112-190:O81058:AC005313
LNK  Q17696_CAEEL/107-180:Q17696:U39849
LNK  Q21367_CAEEL/80-161:Q21367:Z70210
LNK  Q21968_CAEEL/88-155:Q21968:Z50755
LNK  Q21969_CAEEL/89-165:Q21969:Z50755
LNK  Q22871_CAEEL/96-170:Q22871:U60980
LNK  Q39255_ARATH/83-160:Q39255:U60981
LNK  Q89374_CHVP1/68-145:Q89374:U42580
LNK  Q92229_EMENI/83-160:Q92229:U75874
LNK  Q93731_CAEEL/97-174:Q93731:Z81084
LNK  SKP1_HUMAN/84-161:P63208:U33760
AMK  xxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q21367_CAEEL/80-161
ASQ  LTAWDVQFIR.TNSAILLHLAEAAFRLEIVGLLDVACRAVSIML-GRTLNEVKLMLRVGGVESPSD..EEDSLEDVLELEVDVDEN
DSQ  CTCACCGCCTGGGATGTTCAATTTATCCGC...ACCAATAGTGCGATTCTGCTCCATTTGGCTGAAGCGGCTTTTCGTCTGGAAATTGTAGGACTATTGGACGTGGCCTGCAGAGCTGTGTCCATTATGCTC---GGAAGAACTCTAAATGAAGTCAAGCTTATGCTACGAGTTGGAGGAGTTGAGAGCCCATCGGAC......GAGGAAGACAGTCTGGAAGATGTCCTAGAATTGGAAGTAGATGTGGATGAAAAT
TRN  10010101100011011
NAM  Q21969_CAEEL/89-165
ASQ  FSEWDKQFFN.VESGVLFALLNASHALGVEDLMNMGCAAAAELIRGKSTEEIRKIYGIRSD---EE..---QMEEALANGGEGTSA
DSQ  TTTTCCGAATGGGACAAGCAGTTTTTCAAC...GTGGAATCGGGAGTTCTTTTTGCACTACTCAATGCTTCTCATGCGCTTGGAGTCGAAGATTTGATGAATATGGGGTGTGCAGCCGCAGCAGAATTGATTCGAGGAAAAAGCACGGAAGAAATTCGCAAGATCTATGGAATCAGGTCAGAT---------GAAGAA......---------CAAATGGAGGAAGCGTTGGCAAATGGTGGAGAGGGAACATCTGCA
TRN  10010101110011001
NAM  Q89374_CHVP1/68-145
ASQ  IKDFDKGFVN.INMDFMFDLIQGANFLNIKGLLDVLCAAVADRIRGKTPEQIREVFGIENDLTPEE..-----EAAALAEHSWTHL
DSQ  ATTAAAGATTTTGACAAAGGATTCGTGAAT...ATTAATATGGACTTCATGTTTGATCTAATTCAGGGTGCGAATTTCTTGAACATCAAAGGTCTGTTGGACGTTTTGTGTGCAGCGGTTGCTGATCGTATCCGAGGGAAAACGCCAGAACAGATTAGAGAAGTTTTTGGTATTGAAAACGATCTTACACCCGAAGAA......---------------GAAGCTGCTGCTCTTGCAGAACATTCGTGGACTCATTTG
TRN  10010101100011011
NAM  CBF3D_YEAST/115-192
ASQ  VDSWDREFLK.VDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE..-----EAAIRRENEWAED
DSQ  GTGGACTCATGGGACAGAGAATTCCTGAAA...GTGGACCAAGAGATGCTATACGAAATTATTCTGGCGGCAAACTACCTCAACATCAAGCCCTTGCTTGACGCTGGCTGCAAGGTGGTTGCTGAAATGATCAGGGGAAGGTCTCCCGAGGAAATTAGAAGAACGTTTAATATCGTCAACGACTTCACTCCAGAGGAG......---------------GAGGCTGCCATTAGGCGTGAAAATGAATGGGCTGAAGAC
TRN  10010101100011001
NAM  Q92229_EMENI/83-160
ASQ  IEEWDQKFMQ.VDQEMLFEIILAANYLDIKPLLDIGCKTVANMIKGKSPEEIRKTFNIQNDFTPEE..-----EDQIRRENEWAED
DSQ  ATTGAGGAGTGGGACCAGAAGTTCATGCAG...GTTGACCAGGAGATGCTCTTTGAGATAATCTTGGCCGCCAACTACCTTGACATCAAGCCTCTCCTTGACATCGGATGCAAGACTGTCGCCAACATGATCAAGGGCAAGTCCCCCGAGGAAATCCGCAAGACTTTCAACATCCAGAACGACTTCACCCCCGAGGAA......---------------GAGGACCAGATCCGCCGCGAGAACGAATGGGCCGAGGAC
TRN  10010111110111011
NAM  SKP1_HUMAN/84-161
ASQ  IPVWDQEFLK.VDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEE..-----EAQVRKENQWCEE
DSQ  ATCCCTGTTTGGGACCAAGAATTCCTGAAA...GTTGACCAAGGAACACTTTTTGAACTCATTCTGGCTGCAAACTACTTAGACATCAAAGGTTTGCTTGATGTTACATGCAAGACTGTTGCCAATATGATCAAGGGGAAAACTCCTGAGGAGATTCGCAAGACCTTCAATATCAAAAATGACTTTACTGAAGAGGAG......---------------GAAGCCCAGGTACGCAAAGAGAACCAGTGGTGTGAAGAG
TRN  11011101101011010
NAM  Q39255_ARATH/83-160
ASQ  LKAWDADFMK.IDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEE..-----EEEVRRENQWAFE
DSQ  CTTAAGGCCTGGGACGCTGATTTTATGAAG...ATCGATCAAGCTACTCTCTTTGAACTCATTCTGGCTGCTAATTACCTGAATATCAAGAACTTGCTTGATCTAACATGTCAGACAGTTGCGGATATGATCAAAGGAAAGACTCCAGAAGAGATCCGCACAACGTTCAACATTAAGAACGACTTCACACCAGAGGAA......---------------GAGGAAGAGGTTCGCAGAGAGAACCAATGGGCTTTTGAA
TRN  10010101100011011
NAM  O81057_ARATH/71-149
ASQ  FKTWDEEFMKkFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEE..-----EAAVRKENAWAFE
DSQ  TTCAAGACTTGGGACGAAGAGTTCATGAAGaaaTTTGATCAGCCTACGGTCTTCCAACTCTTGCTCGCTGCTAACTATCTCAATATCAAAGGCCTTCTTGATCTCTCTGCTCAAACCGTTGCAGATCGCATCAAAGATAAGACTCCAGAGGAAATTCGAGAAATCTTCAACATCGAGAACGATTTCACACCCGAAGAA......---------------GAAGCAGCGGTTCGCAAGGAAAACGCATGGGCTTTTGAA
TRN  11011101111011011
NAM  O45517_CAEEL/90-167
ASQ  ISEWDAEFMK.VDQGTLFEIILAANYLDIRGLLDVTTQNVANMMKGKTPSQIRTLFNIENDFSEEE..-----REAMKKENAWCED
DSQ  ATTAGTGAATGGGACGCCGAATTCATGAAA...GTCGATCAGGGAACCTTGTTCGAAATTATCTTGGCCGCCAACTACCTCGACATCCGTGGGCTTTTGGACGTGACCACCCAGAATGTGGCTAACATGATGAAGGGTAAAACTCCAAGCCAAATCCGAACCCTCTTCAACATTGAGAACGATTTTTCCGAGGAGGAA......---------------CGGGAGGCCATGAAGAAGGAAAACGCTTGGTGCGAGGAT
TRN  11011101111011011
NAM  Q93731_CAEEL/97-174
ASQ  IQDWDKKFLD.IDQGTLFELILAANYLDIKGLLDVACQSVANMIKGKSPDEIRRAFNIKDDFTAEE..-----REQIRKENAWCDD
DSQ  ATCCAAGACTGGGACAAAAAATTTCTCGAT...ATTGACCAAGGAACCCTTTTCGAGCTCATTTTGGCTGCCAACTATTTGGACATCAAAGGACTTCTTGATGTCGCCTGCCAGTCTGTCGCCAACATGATCAAGGGAAAATCTCCAGATGAAATTCGTCGTGCTTTCAACATCAAGGACGACTTCACTGCAGAGGAG......---------------AGAGAGCAAATCCGTAAGGAAAACGCCTGGTGCGATGAT
TRN  10010101110011011
NAM  O81058_ARATH/112-190
ASQ  LNEWDAKFMKdFDIKTIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEE..-----EEAIRNENAWTFE
DSQ  CTTAATGAGTGGGATGCAAAGTTCATGAAGgatTTCGATATTAAGACGATCTTCGACATTATTCTGGCTGCTAACTATCTCAACGTCCAAGGTCTTTTTGATCTCTGTAGCAAGACCATTGCAGATTACATAAAAGATATGACGCCAGAGGAAGTTCGAGAACTCTTTAACATCGAGAATGATTTCACACCTGAAGAA......---------------GAAGAAGCAATTCGCAATGAAAACGCTTGGACTTTTGAG
TRN  10010101100011011
NAM  O81055_ARATH/89-167
ASQ  LRTWDAEFMKeFDMETVMKLILAVNYLNVQDLLGLTCQTVADHMKDMSPEEVRELFNIENDYTPEE..-----EDAIRKENAWAFE
DSQ  CTCAGGACTTGGGACGCAGAGTTCATGAAAgaaTTTGATATGGAAACAGTCATGAAACTCATTCTCGCTGTTAATTATCTCAACGTCCAAGATCTTCTTGGTCTCACTTGCCAGACCGTTGCAGATCACATGAAAGATATGTCGCCAGAGGAAGTTCGAGAACTCTTTAACATTGAGAATGATTACACACCTGAAGAA......---------------GAAGACGCGATTCGTAAGGAAAACGCTTGGGCTTTTGAG
TRN  10010101110011011
NAM  Q17696_CAEEL/107-180
ASQ  IPSWDRHFLSrLPMSNLFDLITAAYHLDVTGLINYGCKTVANSAKGKNAEEMRELFGI-----PEP..----WEQPSTSTATWDD-
DSQ  ATTCCTTCCTGGGATAGACATTTTCTCAGTagaCTGCCAATGTCAAATTTGTTCGATCTGATTACTGCTGCATATCATTTGGACGTTACCGGACTTATCAATTACGGCTGCAAAACAGTTGCCAATTCTGCGAAAGGAAAAAATGCCGAGGAAATGCGAGAACTTTTCGGAATA---------------CCTGAACCA......------------TGGGAACAACCATCTACATCGACTGCTACATGGGATGAT---
TRN  10010101100011001
NAM  O45357_CAEEL/105-189
ASQ  VPQWDADFLK.ISSDVLFDLIVACNELDVPGLMNYGCKMVADMAAGKSPEDMRTIYGIPTDKQDADaaEKAAKEEAEKNATAQRDE
DSQ  GTTCCCCAATGGGATGCCGACTTCTTGAAA...ATCAGCAGCGATGTGCTCTTCGACTTGATTGTTGCCTGCAACGAACTTGATGTGCCTGGATTGATGAATTATGGATGCAAGATGGTTGCCGACATGGCTGCCGGAAAGTCTCCTGAAGATATGAGAACCATCTATGGAATTCCAACCGATAAACAGGATGCTGATgcagctGAGAAAGCTGCAAAGGAGGAAGCTGAGAAGAATGCTACAGCGCAGAGGGACGAA
TRN  10010101110011011
NAM  Q22871_CAEEL/96-170
ASQ  IPEWDQKFLK.IEDEALFDLILASNFLDIKGLMYFGCKTVSNMAKGKTTAELREIFGINTDEQDAA..-----EETAQRA---AAE
DSQ  ATTCCAGAATGGGATCAGAAGTTCTTGAAA...ATTGAGGATGAAGCTTTGTTTGATTTGATTCTGGCTTCAAACTTCCTTGACATCAAGGGTCTCATGTACTTTGGGTGTAAGACTGTTTCCAACATGGCAAAGGGCAAAACAACTGCTGAACTCAGAGAGATCTTTGGAATCAATACGGATGAACAGGATGCTGCT......---------------GAGGAAACTGCACAGAGAGCT---------GCCGCTGAA
TRN  10010101100011001
NAM  Q21968_CAEEL/88-155
ASQ  IPDWDASFLM.VRHNMLFDIIRAARDFTVPGLFAMCCRVVG-----QNPREI--IDGLVND---EE..-----EEQPVYPVKKCKN
DSQ  ATTCCTGACTGGGATGCGTCGTTTCTGATG...GTGAGGCACAACATGCTCTTTGATATAATCCGAGCCGCGAGGGATTTTACTGTACCTGGTCTCTTCGCCATGTGCTGCCGTGTCGTCGGA---------------CAAAATCCTAGAGAGATT------ATTGACGGATTGGTGAATGAT---------GAAGAG......---------------GAGGAGCAGCCAGTATATCCAGTGAAAAAATGCAAAAAC
TRN  10010101100011011
//