EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01452 - Rota_NSP4)
FAM  PF01452
PID  Rota_NSP4
DES  Rotavirus non structural protein
IPR  IPR002107
ANO  3
ALN  175
AID  0.424924
APH  (VS10_ROTHW/1-174:0.19464,O11981_9REOV/1-174:0.27769,O55588_9REOV/1-169:1.35645);
ATP  (VS10_ROTHW/1-174,O11981_9REOV/1-174,O55588_9REOV/1-169);
ATL  1.82878
DNO  3
DLN  525
DID  0.528357
DPH  (VS10_ROTHW/1-174:0.16491,O11981_9REOV/1-174:0.31602,O55588_9REOV/1-169:0.79185);
DTP  (VS10_ROTHW/1-174,O11981_9REOV/1-174,O55588_9REOV/1-169);
DTL  1.27278
RID  0.424924
RPH  (VS10_ROTHW/1-174:0.19464,O11981_9REOV/1-174:0.27769,O55588_9REOV/1-169:1.35645);
RTP  (VS10_ROTHW/1-174,O11981_9REOV/1-174,O55588_9REOV/1-169);
RTL  1.82878
LNK  O11981_9REOV/1-174:O11981:U96335
LNK  O55588_9REOV/1-169:O55588:AB009627
LNK  VS10_ROTHW/1-174:P03535:K02032
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  VS10_ROTHW/1-174
ASQ  MDKLADLNYTLSVITSMNDTLHSIIQDPGMAYFLYIASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEWESGKNPYEP-SEVTAS
DSQ  ATGGATAAGCTTGCCGACCTCAACTACACATTGAGTGTAATCACTTCAATGAATGACACATTGCATTCTATAATTCAAGATCCTGGAATGGCGTATTTTCTATATATTGCATCTGTTCTAACAGTTTTGTTCACATTACATAAAGCTTCAATTCCAACCATGAAAATAGCATTGAAAACATCAAAATGTTCATATAAAGTGATTAAATATTGTATAGTCACGATCATTAATACTCTTTTAAAATTGGCTGGATATAAAGAGCAGGTTACTACAAAAGACGAAATTGAGCAACAGATGGACAGAATTGTGAAAGAGATGAGACGTCAGCTGGAGATGATTGATAAACTAACTACTCGTGAAATTGAACAGGTTGAATTGCTTAAACGTATACATGACAACCTGATAACTAGACCAGTTGACGTTATAGATATGTCGAAGGAATTCAATCAGAAAAACATCAAAACGCTAGATGAATGGGAGAGTGGAAAAAATCCATATGAACCG---TCAGAAGTGACTGCATCC
TRN  10010101100011000
NAM  O11981_9REOV/1-174
ASQ  MEKLADLNYTLGVITLLNDTLHNILEEPGMVYFPYIASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLAMIEKLTTREIEQVELLKRIYDMMVVRQNREIDMSKETNQKAFKTLHDWGNDRN-YDDNTDVIAP
DSQ  ATGGAGAAACTCGCTGACTTGAACTACACACTTGGCGTTATAACGCTTCTAAATGACACGCTACATAATATACTAGAAGAACCAGGGATGGTCTATTTTCCCTATATTGCATCTGCACTGACTGTTCTATTTACGATGCATAAAGCTTCGCTACCAGCGATGAAACTAGCAATGCGAACTTCCCAGTGTTCTTATAGAATAATTAAGAGGGTGGTGGTCACGTTAATCAACACTCTGCTGAGGCTTGGAGGCTACAACGACTATCTCACAGATAAAGATGAAACAGAAAAGCAAATCAACAGAGTAGTAAAAGAGCTAAGACAGCAACTAGCTATGATCGAGAAACTAACTACACGTGAGATAGAGCAAGTGGAATTACTTAAACGAATATATGATATGATGGTTGTACGTCAGAATCGTGAAATAGACATGTCAAAAGAAACCAATCAAAAAGCGTTTAAAACTCTACATGATTGGGGAAACGATCGTAAT---TATGACGACAATACTGATGTTATCGCGCCA
TRN  10010101100011000
NAM  O55588_9REOV/1-169
ASQ  MENATTINETLVEEVYNMTMSYFEHNVIIMKYFPFLASILTIAFTAWKMGKSTFKVTKTVAGSGFKIVRVVVITIFNCVMRLFGSKTEVVSDDRLDALASKILAQIDNQVKVIEQLTKRELEQVKLLADIYEMLKFKK-DEIDMSFETNKK---EYEKWVKDP--YQPTRAVSLD
DSQ  ATGGAGAACGCTACCACCATCAACGAGACGTTGGTCGAAGAGGTCTATAATATGACAATGAGTTATTTTGAGCACAATGTAATTATTATGAAATATTTTCCATTTTTAGCATCTATTCTGACGATCGCGTTTACAGCGTGGAAAATGGGAAAGTCAACTTTTAAAGTTACTAAAACTGTAGCAGGATCTGGTTTTAAAATTGTCAGAGTAGTAGTTATAACCATATTCAATTGCGTTATGCGTCTATTTGGCTCAAAAACAGAAGTAGTTTCAGACGACAGGCTGGATGCGTTAGCTTCTAAAATACTAGCACAAATTGATAACCAGGTTAAAGTTATAGAACAATTGACAAAACGAGAATTAGAGCAGGTGAAATTACTAGCAGACATCTATGAAATGTTGAAGTTTAAAAAA---GATGAGATTGATATGTCGTTTGAAACTAATAAGAAA---------GAATACGAGAAATGGGTAAAAGATCCA------TATCAACCAACCCGAGCAGTGTCATTAGAT
TRN  10010101100011000
//