EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01410 - COLFI)
FAM  PF01410
PID  COLFI
DES  Fibrillar collagen C-terminal domain
IPR  IPR000885
ANO  12
ALN  227
AID  0.485058
APH  ((((((CO5A2_HUMAN/1279-1495:0.36312,(CO2A1_HUMAN/1200-1417:0.08687,(CO1A1_HUMAN/1245-1463:0.20331,CO1A2_HUMAN/1149-1365:0.30671):0.07476):0.03038):0.05562,CO3A1_HUMAN/1248-1465:0.19592):0.23816,P90679_AREMA/477-683:0.46206):0.07656,((Q26052_PARLI/533-729:0.13356,Q26634_STRPU/1217-1413:0.16029):0.33476,Q26055_PARLI/840-1050:0.68249):0.07205):0.24882,CAF1_EPHMU/359-546:0.64006):0.40320,CO5A1_HUMAN/1625-1836:0.16409,COBA1_HUMAN/1593-1804:0.09804);
ATP  ((((((CO5A2_HUMAN/1279-1495,(CO2A1_HUMAN/1200-1417,(CO1A1_HUMAN/1245-1463,CO1A2_HUMAN/1149-1365))),CO3A1_HUMAN/1248-1465),P90679_AREMA/477-683),((Q26052_PARLI/533-729,Q26634_STRPU/1217-1413),Q26055_PARLI/840-1050)),CAF1_EPHMU/359-546),CO5A1_HUMAN/1625-1836,COBA1_HUMAN/1593-1804);
ATL  5.05633
DNO  10
DLN  681
DID  0.561074
DPH  ((P90679_AREMA/477-683:0.36133,(((Q26052_PARLI/533-729:0.13670,Q26634_STRPU/1217-1413:0.08924):0.21635,Q26055_PARLI/840-1050:0.52119):0.09292,(CO5A1_HUMAN/1625-1836:0.12836,COBA1_HUMAN/1593-1804:0.23385):0.31603):0.06611):0.11147,CO3A1_HUMAN/1248-1465:0.24550,((CO1A1_HUMAN/1245-1463:0.18542,CO2A1_HUMAN/1200-1417:0.11572):0.03301,CO1A2_HUMAN/1149-1365:0.23348):0.04402);
DTP  ((P90679_AREMA/477-683,(((Q26052_PARLI/533-729,Q26634_STRPU/1217-1413),Q26055_PARLI/840-1050),(CO5A1_HUMAN/1625-1836,COBA1_HUMAN/1593-1804))),CO3A1_HUMAN/1248-1465,((CO1A1_HUMAN/1245-1463,CO2A1_HUMAN/1200-1417),CO1A2_HUMAN/1149-1365));
DTL  3.1307
RID  0.497848
RPH  ((((((CO1A1_HUMAN/1245-1463:0.19917,CO1A2_HUMAN/1149-1365:0.31053):0.05706,CO2A1_HUMAN/1200-1417:0.10537):0.06564,CO3A1_HUMAN/1248-1465:0.20936):0.21519,P90679_AREMA/477-683:0.47325):0.06945,((Q26052_PARLI/533-729:0.12468,Q26634_STRPU/1217-1413:0.16822):0.33111,Q26055_PARLI/840-1050:0.67216):0.10652):0.55964,CO5A1_HUMAN/1625-1836:0.11556,COBA1_HUMAN/1593-1804:0.14623);
RTP  ((((((CO1A1_HUMAN/1245-1463,CO1A2_HUMAN/1149-1365),CO2A1_HUMAN/1200-1417),CO3A1_HUMAN/1248-1465),P90679_AREMA/477-683),((Q26052_PARLI/533-729,Q26634_STRPU/1217-1413),Q26055_PARLI/840-1050)),CO5A1_HUMAN/1625-1836,COBA1_HUMAN/1593-1804);
RTL  3.94318
LNK  CAF1_EPHMU/359-546:P18856:
LNK  CO1A1_HUMAN/1245-1463:P02452:Z74615
LNK  CO1A2_HUMAN/1149-1365:P08123:AF004877
LNK  CO2A1_HUMAN/1200-1417:P02458:X16468
LNK  CO3A1_HUMAN/1248-1465:P02461:X14420
LNK  CO5A1_HUMAN/1625-1836:P20908:D90279
LNK  CO5A2_HUMAN/1279-1495:P05997:
LNK  COBA1_HUMAN/1593-1804:P12107:J04177
LNK  P90679_AREMA/477-683:P90679:U68412
LNK  Q26052_PARLI/533-729:Q26052:M25282
LNK  Q26055_PARLI/840-1050:Q26055:J05422
LNK  Q26634_STRPU/1217-1413:Q26634:M92040
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  Q26055_PARLI/840-1050
ASQ  LLEPLG-SRDQPIRSCKDLFKCFQRPKMATTGSDSNEGSIKDRFLAHCVKRGESGSPETCITPRVDEIAP--ARWYEGAS.----GSRY-DLRMGLDKFSY-------EASEVQLTFLRLLSTKAHQNVTYHCKNSVAVHNSQTGSTEQALRLMTTSDVELSPDAPFLEQYEVIGEDGCQDRSAELSQTVIKYSTRRNTRLPIVDVAPSDIGGVDQEFGITLGPVCF
DSQ  CTATTGGAGCCCCTTGGT---AGTCGTGACCAGCCCATCCGTAGCTGTAAGGATCTATTCAAGTGCTTCCAGAGGCCGAAGATGGCAACTACTGGATCGGATTCTAACGAAGGTTCCATCAAGGATCGTTTCCTGGCCCACTGCGTGAAGCGTGGAGAGAGCGGCAGCCCAGAAACTTGCATTACACCACGAGTTGACGAGATTGCACCC------GCAAGATGGTACGAAGGTGCATCC...------------GGATCAAGATAT---GATCTCAGAATGGGTCTAGATAAGTTCTCTTAT---------------------GAAGCCAGTGAAGTGCAACTCACCTTCCTACGTCTACTGTCCACCAAGGCTCACCAGAACGTCACCTACCACTGTAAGAACTCTGTGGCTGTACATAATAGTCAGACTGGATCAACAGAGCAGGCTCTGAGACTCATGACAACATCCGATGTAGAGCTATCACCTGATGCACCATTCTTAGAACAATACGAAGTTATTGGTGAAGACGGTTGTCAAGACCGCTCGGCAGAATTGAGCCAGACTGTTATAAAATATTCAACCAGGAGAAATACCCGTCTTCCTATTGTTGATGTTGCTCCTTCAGACATTGGAGGTGTAGATCAAGAATTCGGAATCACTCTTGGACCAGTCTGTTTT
TRN  10010101100011000
NAM  CAF1_EPHMU/359-546
ASQ  LKSPTG-TKDSPARSCHDLFLEDNSTSDGYYWIDPNGGCIGDAVKVFCN--FTGGVQQTCISATKNAGDL--KSWSGHS-.-----IWFSDML-GGFKLTY------D-ISRSQLQFIRAASRHAVQSFTYKCRNSAA-----------AVIFRTQDNKEIAAN-------KVT-YDGCKSRPSVPDAAFVAVETKRVEQLPIRDFASSDIAGQHQEFGFEMGPACF
NAM  COBA1_HUMAN/1593-1804
ASQ  MKFPMG-TQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCN--FTSG-GETCIYPDKKSEGVRISSWPKEKP.----GSWFSEFK-RGKLLSYLDVEGNS-INMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYD-NNPFIKTLY--DGCTSRKGY-EKTVIEINTPKIDQVPIVDVMISDFGDQNQKFGFEVGPVCF
DSQ  ATGAAATTTCCAATGGGT---ACTCAGACCAATCCAGCCCGAACTTGTAAAGACCTGCAACTCAGCCATCCTGACTTCCCAGATGGTGAATATTGGATTGATCCTAACCAAGGTTGCTCAGGAGATTCCTTCAAAGTTTACTGTAAT------TTCACATCTGGT---GGTGAGACTTGCATTTATCCAGACAAAAAATCTGAGGGAGTAAGAATTTCATCATGGCCAAAGGAGAAACCA...------------GGAAGTTGGTTTAGTGAATTTAAG---AGGGGAAAACTGCTTTCATACTTAGATGTTGAAGGAAATTCC---ATCAATATGGTGCAAATGACATTCCTGAAACTTCTGACTGCCTCTGCTCGGCAAAATTTCACCTACCACTGTCATCAGTCAGCAGCCTGGTATGATGTGTCATCAGGAAGTTATGACAAAGCACTTCGCTTCCTGGGATCAAATGATGAGGAGATGTCCTATGAC---AATAATCCTTTTATCAAAACACTGTAT------GATGGTTGTACGTCCAGAAAAGGCTAT---GAAAAAACTGTCATTGAAATCAATACACCAAAAATTGATCAAGTACCTATTGTTGATGTCATGATCAGTGACTTTGGTGATCAGAATCAGAAGTTCGGATTTGAAGTTGGTCCTGTTTGTTTT
TRN  10010101100011000
NAM  CO5A1_HUMAN/1625-1836
ASQ  MKRPLG-TQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCN--FTAG-GSTCVFPDKKSEGARITSWPKENP.----GSWFSEFK-RGKLLSYVDAEGNP-VGVVQMTFLRLLSASAHQNVTYHCYQSVAWQDAATGSYDKALRFLGSNDEEMSYD-NNPYIRALV--DGCATKKGY-QKTVLEIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPACF
DSQ  ATGAAACGGCCCCTGGGC---ACGCAGCAGAACCCCGCCCGCACCTGCAAGGACCTGCAGCTCTGCCACCCCGACTTCCCAGATGGTGAATACTGGGTCGATCCTAACCAAGGATGCTCCAGGGATTCCTTCAAGGTTTACTGCAAC------TTCACAGCCGGG---GGGTCGACATGCGTCTTCCCTGACAAGAAGTCCGAAGGGGCCAGAATCACTTCTTGGCCCAAAGAAAACCCG...------------GGCTCCTGGTTCAGTGAATTCAAG---CGTGGGAAACTGCTCTCCTATGTGGACGCCGAGGGCAACCCT---GTGGGTGTGGTACAGATGACCTTCCTGCGGCTGCTGAGCGCCTCTGCCCACCAGAACGTCACCTACCACTGCTACCAGTCAGTGGCCTGGCAGGACGCAGCCACGGGCAGCTACGACAAGGCCCTCCGCTTCCTGGGCTCCAACGACGAGGAGATGTCCTATGAC---AACAACCCCTACATCCGCGCCCTGGTG------GACGGCTGTGCTACCAAGAAAGGCTAC---CAGAAGACGGTTCTGGAGATCGACACCCCCAAAGTGGAGCAGGTGCCCATCGTGGACATCATGTTCAATGACTTCGGTGAAGCGTCACAGAAATTTGGATTTGAAGTGGGGCCGGCTTGCTTC
TRN  10010101100011001
NAM  Q26634_STRPU/1217-1413
ASQ  IKAPQGKAKTNPARSCKDVFLNNVEAESGYYWVDPNLGCQKDAIQVYCE--AETG--ATCVPSTNNVVSN--MTWYVGK-.-TK-RAFF-SSMHGGDKFAYIEDS-----T--QMTFLRLLSTSARQTVTYFCKN-------VQGN--P--IFLSSSDVELVDDQDSKFNYRTL-EDGCSSSSSQWGKSVYEYETKKTTRLPIVDFAPGEVGSESQMFGLEMGPVCF
DSQ  ATCAAGGCACCTCAGGGCAAGGCTAAGACCAACCCCGCCAGGTCATGCAAAGACGTCTTCCTCAACAATGTTGAAGCCGAGAGTGGATATTACTGGGTCGATCCCAACCTTGGATGCCAGAAGGATGCCATCCAGGTCTATTGCGAA------GCTGAGACTGGC------GCCACCTGCGTACCCTCAACAAACAATGTTGTCAGCAAC------ATGACATGGTACGTTGGCAAG---...---ACAAAG---CGCGCTTTCTTC---TCCAGCATGCATGGTGGTGACAAGTTCGCCTACATCGAGGACTCT---------------ACC------CAGATGACCTTCCTCCGCCTCCTCTCCACCAGCGCCCGCCAGACCGTCACCTACTTCTGCAAGAAC---------------------GTCCAAGGAAAC------CCA------ATCTTCCTCTCAAGCTCTGATGTCGAACTGGTCGATGACCAGGACAGCAAATTCAACTACAGGACACTT---GAAGATGGCTGCTCATCCTCATCATCACAGTGGGGCAAGTCTGTCTACGAATATGAGACCAAGAAGACAACACGTCTGCCGATCGTTGATTTCGCCCCAGGTGAAGTTGGCAGTGAAAGTCAGATGTTTGGCCTGGAGATGGGACCTGTGTGCTTT
TRN  10010101100011001
NAM  Q26052_PARLI/533-729
ASQ  IKTPQGKSQNNPARSCKDIFLNDANAESGTYWVDPNLGCHQDAIQVHCE--QETQ--ATCVSPSMSQIIN--STWYVGK-.-VK-RTYF-STMEGGDKFSYIEEP-----T--QMTFLRLLSTSARQTVTYYCKN-------VAGN--P--IFRSSSEIELVDDETSKFNYNII-EDGCSTATSQKGKSVYEYETKKTTRLPIVDFAPGEVGLENQKFGLEMGPVCF
DSQ  ATCAAGACTCCTCAGGGCAAGTCTCAGAACAACCCCGCCAGGTCATGCAAGGATATCTTCCTTAACGACGCCAACGCAGAGAGTGGAACTTACTGGGTGGACCCCAACCTTGGATGTCATCAAGATGCTATCCAGGTCCATTGTGAA------CAAGAAACTCAA------GCCACCTGTGTATCTCCATCAATGAGCCAGATCATCAAC------AGCACATGGTACGTCGGCAAG---...---GTAAAG---CGTACCTACTTC---TCCACAATGGAAGGCGGAGACAAGTTCTCATACATTGAAGAACCT---------------ACC------CAGATGACCTTCCTGCGTCTCCTCTCCACCAGCGCCCGCCAAACCGTCACTTACTACTGCAAGAAC---------------------GTTGCAGGCAAC------CCC------ATCTTCCGCTCTAGCTCTGAGATCGAACTTGTAGATGATGAAACCAGCAAATTCAACTACAATATAATT---GAGGATGGCTGCTCGACCGCAACATCACAGAAAGGCAAGTCTGTCTACGAGTATGAGACCAAGAAGACAACGCGTCTTCCAATCGTTGATTTCGCCCCTGGTGAAGTTGGACTTGAAAACCAAAAGTTTGGCCTGGAGATGGGACCTGTGTGCTTT
TRN  10010101100011001
NAM  P90679_AREMA/477-683
ASQ  FKNPTG-THAAPARTCKDLAMAHPEFEDGMYWVDPNQGSPVDAIEVFCD--IQAH--QTCVMAKPGQIFK--GVWYRGE-.-PG-HVWFADEMENGLLVHL--Q-----GGNVQMTFLQLLSTEAVQNITYHCKNSVAYYDKANDNLDSAAMFMTSNDLELNAD-KPKFRYEVL-LDECQHKQSKWTKTVFEFKTTKTRRLPIVDIAPSDIGGEDQAFGLEIGPVCF
DSQ  TTCAAGAATCCCACCGGC---ACCCACGCCGCCCCTGCCCGCACCTGCAAGGACCTCGCCATGGCACACCCGGAGTTCGAGGACGGTATGTACTGGGTCGACCCCAACCAGGGCAGTCCGGTGGACGCCATCGAAGTATTCTGCGAC------ATCCAGGCCCAC------CAGACCTGCGTCATGGCCAAGCCCGGACAGATCTTCAAG------GGGGTGTGGTACCGGGGCGAG---...---CCTGGC---CACGTCTGGTTCGCCGATGAGATGGAAAACGGTCTTCTCGTTCACCTA------CAA---------------GGCGGCAATGTCCAGATGACCTTCCTGCAGCTGCTGAGCACGGAGGCCGTGCAGAACATCACTTACCACTGCAAGAACTCGGTCGCCTACTACGACAAGGCCAACGACAACCTCGACAGCGCAGCCATGTTTATGACCTCCAACGACCTTGAGCTCAATGCCGAC---AAGCCCAAGTTCCGATACGAAGTTCTC---CTGGATGAATGTCAGCACAAGCAGAGCAAATGGACCAAGACCGTATTTGAGTTCAAGACGACCAAGACGAGGCGGCTGCCAATCGTGGACATTGCACCGTCCGACATTGGCGGGGAGGACCAGGCATTCGGCTTGGAAATAGGCCCAGTGTGCTTT
TRN  10010101100011011
NAM  CO5A2_HUMAN/1279-1495
ASQ  MRSPDG-SKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSVEDAIKVYCN--METG--ETCISANPSSVPR--KTWWASKS.PDNKPVWYGLDMNRGSQFAY-GDHQSPNTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIRFRYIVL-QDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCF
NAM  CO1A2_HUMAN/1149-1365
ASQ  LLTPEG-SRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMEAIKVYCD--FPTG--ETCIRAQPENIPA--KNWYRSS-.KDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVL-VDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADHEFFVDIGPVCF
DSQ  CTTCTTACTCCTGAAGGC---TCTAGAAAGAACCCAGCTCGCACATGCCGTGACTTGAGACTCAGCCACCCAGAGTGGAGCAGTGGTTACTACTGGATTGACCCCAACCAAGGATGCACTATGGAAGCCATCAAAGTATACTGTGAT------TTCCCTACCGGC------GAAACCTGTATCCGGGCCCAACCTGAAAACATCCCAGCC------AAGAACTGGTATAGGAGCTCC---...AAGGACAAGAAACACGTCTGGCTAGGAGAAACTATCAATGCTGGCAGCCAGTTTGAATATAATGTTGAAGGAGTGACTTCCAAGGAAATGGCTACCCAACTTGCCTTCATGCGCCTGCTGGCCAACTATGCCTCTCAGAACATCACCTACCACTGCAAGAACAGCATTGCATACATGGATGAGGAGACTGGCAACCTGAAAAAGGCTGTCATTCTACAGGGCTCTAATGATGTTGAACTTGTTGCTGAGGGCAACAGCAGGTTCACTTACACTGTTCTT---GTAGATGGCTGCTCTAAAAAGACAAATGAATGGGGAAAGACAATCATTGAATACAAAACAAATAAGCCATCACGCCTGCCCTTCCTTGATATTGCACCTTTGGACATCGGTGGTGCTGACCATGAATTCTTTGTGGACATTGGCCCAGTCTGTTTC
TRN  10010101100011001
NAM  CO3A1_HUMAN/1248-1465
ASQ  LISPDG-SRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCN--METG--ETCISANPLNVPR--KHWWTDSS.AEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVL-EDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCF
DSQ  CTCATTAGTCCTGATGGT---TCTCGTAAAAACCCCGCTAGAAACTGCAGAGACCTGAAATTCTGCCATCCTGAACTCAAGAGTGGAGAATACTGGGTTGACCCTAACCAAGGATGCAAATTGGATGCTATCAAGGTATTCTGTAAT------ATGGAAACTGGG------GAAACATGCATAAGTGCCAATCCTTTGAATGTTCCACGG------AAACACTGGTGGACAGATTCTAGT...GCTGAGAAGAAACACGTTTGGTTTGGAGAGTCCATGGATGGTGGTTTTCAGTTTAGCTACGGCAATCCTGAACTTCCTGAAGATGTCCTTGATGTGCAGCTGGCATTCCTTCGACTTCTCTCCAGCCGAGCTTCCCAGAACATCACATATCACTGCAAAAATAGCATTGCATACATGGATCAGGCCAGTGGAAATGTAAAGAAGGCCCTGAAGCTGATGGGGTCAAATGAAGGTGAATTCAAGGCTGAAGGAAATAGCAAATTCACCTACACAGTTCTG---GAGGATGGTTGCACGAAACACACTGGGGAATGGAGCAAAACAGTCTTTGAATATCGAACACGCAAGGCTGTGAGACTACCTATTGTAGATATTGCACCCTATGACATTGGTGGTCCTGATCAAGAATTTGGTGTGGACGTTGGCCCTGTTTGCTTT
TRN  10010101100011001
NAM  CO2A1_HUMAN/1200-1417
ASQ  IRSPEG-SRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCN--METG--ETCVYPNPANVPK--KNWWSSKS.KEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTAL-KDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF
DSQ  ATCCGCAGCCCCGAGGGC---TCCCGCAAGAACCCTGCTCGCACCTGCAGAGACCTGAAACTCTGCCACCCTGAGTGGAAGAGTGGAGACTACTGGATTGACCCCAACCAAGGCTGCACCTTGGACGCCATGAAGGTTTTCTGCAAC------ATGGAGACTGGC------GAGACTTGCGTCTACCCCAATCCAGCAAACGTTCCCAAG------AAGAACTGGTGGAGCAGCAAGAGC...AAGGAGAAGAAACACATCTGGTTTGGAGAAACCATCAATGGTGGCTTCCATTTCAGCTATGGAGATGACAATCTGGCTCCCAACACTGCCAACGTCCAGATGACCTTCCTACGCCTGCTGTCCACGGAAGGCTCCCAGAACATCACCTACCACTGCAAGAACAGCATTGCCTATCTGGACGAAGCAGCTGGCAACCTCAAGAAGGCCCTGCTCATCCAGGGCTCCAATGACGTGGAGATCCGGGCAGAGGGCAATAGCAGGTTCACGTACACTGCCCTG---AAGGATGGCTGCACGAAACATACCGGTAAGTGGGGCAAGACTGTTATCGAGTACCGGTCACAGAAGACCTCACGCCTCCCCATCATTGACATTGCACCCATGGACATAGGAGGGCCCGAGCAGGAATTCGGTGTGGACATAGGGCCGGTCTGCTTC
TRN  10010101100011001
NAM  CO1A1_HUMAN/1245-1463
ASQ  IRSPEG-SRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCN--METG--ETCVYPTQPSVAQ--KNWYISKNpKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLKGSNEIEIRAEGNSRFTYSVT-VDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCF
DSQ  ATCCGGAGCCCAGAGGGA---AGCCGCAAGAACCCCGCCCGCACCTGCCGTGACCTCAAGATGTGCCACTCTGACTGGAAGAGTGGAGAGTACTGGATTGACCCCAACCAAGGCTGCAACCTGGATGCCATCAAAGTCTTCTGCAAC------ATGGAGACTGGT------GAGACCTGCGTGTACCCCACTCAGCCCAGTGTGGCCCAG------AAGAACTGGTACATCAGCAAGAACcccAAGGACAAGAGGCATGTCTGGTTCGGCGAGAGCATGACCGATGGATTCCAGTTCGAGTATGGCGGCCAGGGCTCCGACCCTGCCGATGTGGCCATCCAGCTGACCTTCCTGCGCCTGATGTCCACCGAGGCCTCCCAGAACATCACCTACCACTGCAAGAACAGCGTGGCCTACATGGACCAGCAGACTGGCAACCTCAAGAAGGCCCTGCTCCTCAAGGGCTCCAACGAGATCGAGATCCGCGCCGAGGGCAACAGCCGCTTCACCTACAGCGTCACT---GTCGATGGCTGCACGAGTCACACCGGAGCCTGGGGCAAGACAGTGATTGAATACAAAACCACCAAGTCCTCCCGCCTGCCCATCATCGATGTGGCCCCCTTGGACGTTGGTGCCCCAGACCAGGAATTCGGCTTCGACGTTGGCCCTGTCTGCTTC
TRN  10010101100011011
//