EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01406 - tRNA-synt_1e)
FAM  PF01406
PID  tRNA-synt_1e
DES  tRNA synthetases class I (C) catalytic domain
IPR  IPR002308
ANO  12
ALN  442
AID  0.442862
APH  (((SYC_HELPY/13-317:0.51518,SYC_ARCFU/14-316:0.30674):0.10692,(SYC_BACSU/15-314:0.30799,SYC_SYNY3/15-320:0.39143):0.12087):0.07837,((SYC_AZOBR/15-306:0.63137,SYC1_MYCTU/19-315:0.46858):0.12316,(SYC_ECOLI/14-314:0.12111,SYC_HAEIN/14-314:0.13210):0.25487):0.09375,((SYC_MYCGE/9-301:0.16967,SYC_MYCPN/17-310:0.09261):0.67044,(SYC_SCHPO/34-456:0.28506,SYC_YEAST/49-475:0.24104):0.51590):0.19156);
ATP  (((SYC_HELPY/13-317,SYC_ARCFU/14-316),(SYC_BACSU/15-314,SYC_SYNY3/15-320)),((SYC_AZOBR/15-306,SYC1_MYCTU/19-315),(SYC_ECOLI/14-314,SYC_HAEIN/14-314)),((SYC_MYCGE/9-301,SYC_MYCPN/17-310),(SYC_SCHPO/34-456,SYC_YEAST/49-475)));
ATL  5.81872
DNO  11
DLN  1326
DID  0.502992
DPH  (((((SYC_SYNY3/15-320:0.32919,(SYC_ARCFU/14-316:0.33976,((SYC_ECOLI/14-314:0.12818,SYC_HAEIN/14-314:0.26224):0.18012,SYC1_MYCTU/19-315:0.44965):0.07698):0.06747):0.07340,SYC_BACSU/15-314:0.31496):0.09878,SYC_HELPY/13-317:0.39981):0.08136,(SYC_SCHPO/34-456:0.32726,SYC_YEAST/49-475:0.25412):0.29945):0.38021,SYC_MYCGE/9-301:0.17730,SYC_MYCPN/17-310:0.21569);
DTP  (((((SYC_SYNY3/15-320,(SYC_ARCFU/14-316,((SYC_ECOLI/14-314,SYC_HAEIN/14-314),SYC1_MYCTU/19-315))),SYC_BACSU/15-314),SYC_HELPY/13-317),(SYC_SCHPO/34-456,SYC_YEAST/49-475)),SYC_MYCGE/9-301,SYC_MYCPN/17-310);
DTL  4.45593
RID  0.451866
RPH  (SYC_SCHPO/34-456:0.31265,((((SYC_SYNY3/15-320:0.39766,SYC_BACSU/15-314:0.30787):0.11323,(SYC_ARCFU/14-316:0.31336,SYC_HELPY/13-317:0.51637):0.11280):0.08327,(SYC1_MYCTU/19-315:0.58377,(SYC_HAEIN/14-314:0.13868,SYC_ECOLI/14-314:0.11388):0.27336):0.06980):0.18967,(SYC_MYCPN/17-310:0.08472,SYC_MYCGE/9-301:0.17921):0.67784):0.51242,SYC_YEAST/49-475:0.21804);
RTP  (SYC_SCHPO/34-456,((((SYC_SYNY3/15-320,SYC_BACSU/15-314),(SYC_ARCFU/14-316,SYC_HELPY/13-317)),(SYC1_MYCTU/19-315,(SYC_HAEIN/14-314,SYC_ECOLI/14-314))),(SYC_MYCPN/17-310,SYC_MYCGE/9-301)),SYC_YEAST/49-475);
RTL  5.1986
LNK  SYC1_MYCTU/19-315:P96862:BX842583
LNK  SYC_ARCFU/14-316:O29836:AE001076
LNK  SYC_AZOBR/15-306:O07045:
LNK  SYC_BACSU/15-314:Q06752:L14580
LNK  SYC_ECOLI/14-314:P21888:X56234
LNK  SYC_HAEIN/14-314:P43816:U32693
LNK  SYC_HELPY/13-317:P41259:AE000598
LNK  SYC_MYCGE/9-301:P47495:U39704
LNK  SYC_MYCPN/17-310:P75423:AE000047
LNK  SYC_SCHPO/34-456:Q09860:Z66525
LNK  SYC_SYNY3/15-320:P74330:D90914
LNK  SYC_YEAST/49-475:P53852:X96722
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  SYC_YEAST/49-475
ASQ  FIPQSGNRGVTWYSCGPTVYDASHMGHARNYVSIDINRRIIQDYFGYDVQFVQNVTDIDDKIILRARQNYLFDNFVKENDT.KFNATVVDKVKTALFQYINKNFTIQGSEIKTIEEFETWLSNADTETLKLENPKFPMHVTAVQNAIESITKGDSMDAEVAFEKVKDVTVPLLDKELGSTISNPEIFRQLPAYWEQKFNDDMLSLNVLPPTVTTRVSEYVPEIIDFVQKIIDNGYAYATSDGSVYFDTLKFDKSPNHDYAKCQPWNKGQLDLINDGEGSLSNFADNGKKSNNDFALWKASKAGE...-PEWESPWGKGRPGWHIECSVMASDILG.....SNIDIHSGGIDLAFPHHDNELAQSEARFDNQQWINYFLHTGHLHI----EGQKMSKSLKNFITIQEALKKFSPRQLRLAF.ASVQWNNQLDFKESLIHEVKS
DSQ  TTCATTCCGCAATCTGGCAATAGAGGTGTCACTTGGTACTCTTGCGGTCCTACTGTTTACGATGCCTCCCATATGGGTCATGCCAGAAACTATGTCTCTATTGATATCAATAGAAGAATTATTCAAGATTATTTTGGTTACGACGTGCAATTTGTGCAAAATGTTACTGATATCGACGATAAAATTATTTTGAGAGCTAGACAAAACTATTTATTTGACAATTTTGTCAAAGAAAATGATACC...AAATTCAACGCCACTGTTGTTGACAAGGTCAAAACCGCACTTTTCCAATATATCAACAAAAATTTTACTATTCAAGGCAGCGAGATCAAAACTATCGAAGAATTTGAAACTTGGTTATCGAATGCTGATACTGAAACTTTAAAATTGGAGAATCCTAAATTCCCTATGCATGTCACCGCAGTTCAAAATGCTATTGAATCAATCACTAAGGGCGATTCCATGGACGCAGAAGTTGCCTTTGAAAAAGTCAAGGACGTTACGGTTCCTCTATTGGATAAAGAATTGGGCTCTACCATTAGCAATCCAGAGATTTTCCGCCAACTTCCAGCTTACTGGGAACAGAAATTCAATGATGACATGTTATCATTAAACGTGCTACCTCCCACCGTTACAACTCGTGTTTCTGAGTACGTTCCAGAAATTATTGACTTTGTTCAAAAAATTATTGATAATGGTTACGCATATGCCACTTCCGACGGTTCCGTGTACTTTGATACTTTAAAATTTGACAAATCCCCAAATCATGACTATGCTAAATGCCAGCCATGGAATAAGGGCCAGTTAGACTTAATTAATGATGGTGAAGGGTCCTTAAGCAACTTTGCTGATAACGGAAAAAAGTCGAATAATGATTTTGCTTTATGGAAGGCTTCCAAGGCAGGTGAA.........---CCTGAGTGGGAATCACCATGGGGTAAGGGTAGACCAGGATGGCATATTGAATGTTCTGTGATGGCCAGTGATATCCTAGGC...............TCTAACATCGATATTCATTCAGGTGGCATCGATTTGGCCTTTCCTCACCATGATAACGAATTGGCTCAATCCGAGGCTCGCTTCGACAATCAACAGTGGATCAACTATTTCTTACATACGGGCCATTTACATATT------------GAGGGTCAAAAAATGTCTAAATCCTTAAAGAATTTCATTACCATTCAAGAAGCTTTGAAAAAATTCTCACCGCGCCAATTAAGATTGGCTTTT...GCCTCAGTACAATGGAACAATCAATTGGATTTCAAGGAATCTTTGATCCATGAAGTAAAGTCA
TRN  10010101110011000
NAM  SYC_SCHPO/34-456
ASQ  FVSNGSN--LTWYCCGPTVYDASHMGHARNYVTTDILRRILQSYFGYNITFVQNVTDIDDKIILRARQQYLFEEYKKQQGTnKSHSEAREKVTEAWFAYAKKNLPEPPSSMSEWPQWLASHDIPTLAINNPKLPMHVDALKSALDALQVSEASEIISLDGFWPKVQDVLVPLLDAELGSTVTDPAIFRKLAAYWEDDFNKDMANLNVLPPTAVTRVSEYVPEIVDFVQRIIDRGYAYPVTDGSVYFDTEAFEKG-GHFYAKLEPWNKGNRELIAEGEGSLA--ALTGKKRPGDFALWKASKPGE...-PSWDSPWSKGRPGWHIECSVMASALLG.....SNIDIHSGGIDLAFPHHDNELAQSEAYFDCPQWVNYFFHAGHLHI----EGQKMSKSLKNFITIKEILKKFTPRQLRLAF.LLQQWNTQLDFKETLLAYVLN
DSQ  TTTGTTTCAAATGGTTCCAAC------TTAACATGGTACTGCTGTGGACCTACGGTATATGATGCTAGTCATATGGGGCATGCTCGTAATTATGTGACAACTGATATCCTTCGAAGAATCTTACAATCTTATTTTGGATATAACATTACATTTGTACAAAACGTTACTGATATAGATGACAAAATTATCCTTAGAGCTCGTCAACAATATTTATTTGAAGAATATAAAAAGCAGCAAGGTACTaacAAATCCCATTCAGAAGCTCGTGAAAAGGTTACTGAGGCTTGGTTTGCATATGCCAAGAAAAATCTTCCTGAACCTCCCTCCTCGATGAGTGAATGGCCTCAATGGCTCGCATCCCATGATATTCCCACTTTAGCTATCAACAATCCCAAGTTACCCATGCATGTGGATGCTTTAAAGTCTGCTTTGGACGCTCTTCAGGTGAGTGAAGCTTCTGAAATCATTTCTTTGGATGGGTTTTGGCCCAAGGTACAAGATGTTTTGGTCCCATTGCTTGATGCAGAATTGGGTAGCACCGTGACTGATCCTGCAATCTTTCGTAAACTTGCAGCTTATTGGGAAGATGACTTCAACAAGGACATGGCTAATCTGAATGTCTTGCCACCTACTGCTGTTACGCGAGTTTCGGAATATGTTCCTGAAATCGTAGATTTTGTTCAGCGCATTATCGATCGCGGTTATGCTTATCCAGTTACAGACGGTAGCGTTTACTTCGACACAGAGGCTTTCGAAAAAGGT---GGTCATTTTTATGCTAAATTGGAGCCCTGGAATAAAGGAAATCGAGAGTTAATTGCTGAGGGCGAGGGTTCCTTGGCT------GCTCTCACCGGTAAAAAGCGTCCGGGAGACTTTGCGCTTTGGAAGGCCAGTAAACCTGGTGAA.........---CCCTCTTGGGATAGTCCTTGGTCCAAAGGACGTCCTGGTTGGCATATCGAATGTTCTGTCATGGCTAGCGCTCTACTTGGT...............TCCAATATTGATATTCACTCTGGTGGAATTGATTTGGCATTCCCTCATCACGATAATGAGTTGGCACAAAGTGAGGCCTATTTTGACTGTCCCCAATGGGTGAATTATTTCTTTCATGCAGGTCATTTGCATATT------------GAAGGCCAGAAAATGTCTAAATCTCTTAAAAATTTTATCACTATTAAAGAAATTTTAAAGAAGTTTACACCTAGACAATTACGCTTGGCATTC...TTACTTCAACAATGGAACACTCAACTCGATTTTAAGGAGACCCTTTTGGCATATGTCTTAAAC
TRN  10010101100011000
NAM  SYC1_MYCTU/19-315
ASQ  DFVPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLLA-RGYDVAFIRNVTDIEDKILAKAAAAGRP---------.--------------------------------------------------------------------------------------------------------WWEWAATHERAFTAAYDALDVLPPSAEPRATGHITQMIEMIERLIQAGHAYTGG------GDVYFDVLSYPEYGQLSGHKIDDVHQGEGVAAG--------KRDQRDFTLWKGEKPGE...-PSWPTPWGRGRPGWHLECSAMARSYLG.....PEFDIHCGGMDLVFPHHENEIAQSRAAGD--GFARYWLHNGWVTM----GGEKMSKSLGNVLSMPAMLQRVRPAELRYYL.GSAHYRSMLEFSETAMQDAVK
DSQ  GATTTCGTCCCGTTGCGACCTGGACACGTCTCGATCTACCTGTGCGGTGCCACGGTGCAGGGCCTACCGCATATCGGGCATGTCCGCAGCGGGGTCGCCTTCGACATCCTGCGCCGATGGTTGCTCGCG---CGTGGCTACGACGTCGCGTTTATCCGCAACGTGACCGACATCGAAGACAAGATCCTGGCCAAGGCCGCCGCGGCGGGCCGGCCG---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TGGTGGGAGTGGGCGGCTACCCACGAGCGTGCCTTCACCGCGGCCTACGACGCTCTGGACGTCTTGCCGCCGTCCGCGGAGCCGCGCGCCACCGGGCATATCACCCAGATGATCGAGATGATCGAGCGCCTGATCCAGGCCGGCCACGCGTATACCGGTGGC------------------GGTGACGTTTACTTCGACGTTCTGAGCTACCCGGAGTACGGCCAGTTATCCGGTCACAAGATCGATGACGTCCATCAGGGCGAAGGTGTGGCTGCCGGC------------------------AAGCGGGACCAGCGCGACTTCACTTTGTGGAAGGGCGAAAAGCCGGGTGAA.........---CCGTCGTGGCCGACGCCGTGGGGCCGCGGGCGTCCGGGCTGGCATCTGGAATGCTCGGCAATGGCTCGCAGCTATCTCGGG...............CCGGAATTCGATATCCATTGCGGTGGAATGGATTTAGTCTTCCCGCATCATGAGAACGAAATCGCCCAGAGCCGCGCCGCCGGTGAT------GGGTTCGCCCGCTACTGGCTGCACAATGGCTGGGTGACGATG------------GGCGGGGAGAAGATGAGCAAGTCGCTGGGCAACGTGTTGTCCATGCCGGCGATGTTGCAGCGGGTGCGGCCGGCTGAGCTGCGTTATTACCTG...GGCAGCGCGCACTACCGGTCGATGCTCGAGTTCTCCGAGACCGCTATGCAGGATGCGGTGAAA
TRN  11011101101011010
NAM  SYC_SYNY3/15-320
ASQ  PLQPLHPGLVTMYCCGITVYDYCHLGHARTCITWDLVRRYLQW-SGYEVRYVQNFTDIDDKILKRAVDESST---------.--------------------------------------------------------------------------------------------------------MEAVSEKFIAAYFEDMEALGVQPADLYPRATHTLDGIKRLIAELEAKGYAYPSG------GDVYYSVRNFDGYGKLSGRRLEDLQAGASGRVTVADPDGAQKQDPFDFALWKSAKPGE...-PAWESPWGKGRPGWHIECSAMVREFLG.....ETIDLHVGGNDLIFPHHENEIAQSEAVTG-QPLAQYWLHNGMVKV----DGEKMSKSLGNFTTIRALLKTVDPMAIRLLV.LQGHYRKPLDFTETAIAAATN
DSQ  CCCCTGCAACCTCTCCACCCTGGCCTGGTGACAATGTACTGTTGCGGCATCACCGTCTATGACTATTGCCACCTAGGCCACGCCCGTACCTGCATTACCTGGGATTTGGTGCGTCGTTACCTGCAATGG---TCGGGTTATGAGGTGCGCTATGTGCAAAATTTCACTGATATTGACGACAAAATCCTCAAACGGGCAGTGGACGAAAGCTCCACC---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ATGGAGGCGGTGTCAGAAAAATTTATCGCCGCCTATTTTGAAGATATGGAAGCGTTGGGAGTGCAACCAGCGGATCTTTACCCCAGGGCTACCCACACCCTAGATGGCATTAAAAGGTTAATTGCGGAGTTGGAAGCTAAGGGCTACGCCTATCCCAGCGGT------------------GGAGATGTCTATTACTCAGTGCGTAATTTTGACGGCTACGGCAAGCTCTCTGGACGCAGGCTAGAGGATTTGCAGGCGGGGGCCAGCGGCCGGGTGACAGTGGCCGATCCCGATGGAGCCCAAAAACAGGACCCGTTTGATTTCGCCTTATGGAAAAGCGCTAAACCGGGGGAA.........---CCGGCCTGGGAATCTCCTTGGGGTAAGGGGCGGCCGGGCTGGCACATTGAATGTTCCGCCATGGTGAGGGAATTTTTAGGG...............GAAACTATTGATCTACATGTGGGGGGCAATGATTTAATTTTTCCCCACCACGAAAATGAAATTGCCCAATCGGAGGCGGTGACGGGT---CAACCCCTGGCCCAGTATTGGCTCCATAACGGCATGGTGAAGGTA------------GATGGAGAAAAAATGTCCAAATCCCTGGGGAACTTCACCACCATTCGGGCTTTGCTAAAAACCGTTGACCCCATGGCAATCAGACTTTTGGTT...CTCCAAGGTCATTACCGTAAACCGCTAGATTTCACCGAGACGGCGATCGCCGCCGCCACTAAT
TRN  10010101100011000
NAM  SYC_BACSU/15-314
ASQ  TFVPLEEGKVKMYVCGPTVYNYIHIGNARPAIVYDTVRNYLEY-KGYDVQYVSNFTDVDDKLIKAANELGED---------.--------------------------------------------------------------------------------------------------------VPTISERFIKAYFEDVGALGCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESE------GDVYFKTRAFEGYGKLSQQSIDELRSGARIRV------GEKKEDALDFALWKAAKEGE...-ISWDSPWGKGRPGWHIECSAMVKKYLG.....DQIDIHAGGQDLTFPHHENEIAQSEALTG-KTFAKYWLHNGYINI----DNEKMSKSLGNFVLVHDIIKQHDPQLLRFFM.LSVHYRHPINYSEELLENTKS
DSQ  ACATTCGTTCCTCTTGAAGAGGGAAAAGTGAAAATGTATGTATGCGGACCCACGGTTTACAATTACATTCATATCGGGAACGCGCGTCCGGCAATCGTTTACGATACGGTTCGAAACTATTTAGAGTAT---AAAGGCTATGATGTGCAGTATGTCTCTAACTTCACAGACGTAGACGATAAATTAATTAAAGCGGCAAATGAACTCGGTGAGGAT---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GTACCCACCATTTCAGAGCGTTTTATTAAAGCATACTTTGAAGACGTAGGTGCGCTCGGCTGCCGAAAAGCCGACCTTCATCCGCGAGTAATGGAGAACATGGATGCCATTATCGAATTCGTAGATCAGCTCGTGAAAAAGGGCTACGCATATGAATCAGAA------------------GGTGACGTATATTTCAAAACCAGAGCATTTGAAGGGTACGGAAAGCTTTCTCAGCAATCAATCGATGAACTAAGATCAGGTGCACGCATCCGGGTC------------------GGCGAGAAAAAAGAAGATGCTCTTGATTTCGCACTGTGGAAAGCGGCAAAAGAAGGAGAA.........---ATCTCTTGGGATAGCCCTTGGGGGAAAGGGCGTCCGGGCTGGCACATTGAATGCTCAGCAATGGTGAAAAAGTATCTCGGT...............GACCAGATTGATATCCATGCGGGCGGACAGGATTTAACATTCCCTCACCATGAAAACGAAATTGCGCAATCTGAGGCGCTGACAGGC---AAAACGTTTGCGAAGTACTGGCTTCATAATGGTTATATCAATATT------------GATAATGAAAAAATGTCAAAATCACTAGGCAACTTTGTGCTTGTGCATGACATCATTAAACAGCATGATCCGCAGCTTTTGAGATTCTTTATG...CTATCTGTTCATTATCGCCATCCGATTAACTATTCAGAAGAGCTTCTGGAGAATACGAAAAGC
TRN  10010101100011000
NAM  SYC_HAEIN/14-314
ASQ  IFKPIHENKVGMYVCGVTVYDLCHIGHGRTFVCFDVIARYLRS-LGYDLTYVRNITDVDDKIIKRALENKET---------.--------------------------------------------------------------------------------------------------------CDQLVDRMVQEMYKDFDALNVLRPDFEPRATHHIPEIIEIVEKLIKRGHAYVADN-----GDVMFDVESFKEYGKLSRQDLEQLQAGARIEIN------EIKKNPMDFVLWKMSKENE...-PSWASPWGAGRPGWHIECSAMNCKQLG.....EYFDIHGGGSDLMFPHHENEIAQSCCAHG-GQYVNYWIHSGMIMV----DKEKMSKSLGNFFTIRDVLNHYNAEAVRYFL.LTAHYRSQLNYSEENLNLAQG
DSQ  ATCTTTAAACCTATCCACGAAAATAAAGTGGGAATGTATGTTTGCGGCGTCACTGTTTATGATTTGTGCCATATCGGCCATGGACGCACTTTTGTGTGTTTTGATGTGATTGCCCGTTATTTACGTTCT---TTGGGTTACGATTTAACTTATGTGCGTAATATAACGGACGTAGATGACAAAATTATTAAACGTGCGTTAGAAAACAAAGAAACC---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TGCGATCAGTTAGTGGATCGCATGGTGCAGGAAATGTATAAAGATTTTGATGCACTTAATGTCTTACGCCCTGATTTTGAACCTCGTGCGACGCATCATATTCCAGAAATTATTGAAATTGTGGAAAAATTAATTAAACGCGGACATGCTTATGTTGCGGATAAT---------------GGGGACGTGATGTTTGATGTAGAAAGCTTCAAAGAATACGGCAAATTATCCCGTCAAGATCTTGAGCAATTACAAGCTGGCGCACGTATTGAAATCAAT------------------GAAATCAAGAAAAATCCAATGGATTTCGTGCTTTGGAAAATGTCGAAAGAAAACGAA.........---CCAAGTTGGGCTTCCCCTTGGGGGGCAGGTCGTCCGGGTTGGCATATTGAATGTTCTGCAATGAACTGCAAACAGCTTGGC...............GAATATTTTGATATTCACGGTGGTGGCTCTGATTTAATGTTCCCTCACCACGAAAATGAAATTGCACAATCTTGCTGTGCGCATGGC---GGCCAATATGTGAATTATTGGATCCATTCTGGCATGATTATGGTG------------GATAAAGAAAAAATGTCGAAATCCCTCGGCAATTTCTTCACAATTCGTGATGTATTAAACCACTACAATGCAGAAGCGGTGCGTTATTTCTTA...TTAACGGCACATTATCGTAGCCAGCTCAATTATAGCGAAGAAAACTTGAATTTAGCACAAGGT
TRN  10010101110011010
NAM  SYC_ECOLI/14-314
ASQ  EFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRF-LGYKLKYVRNITDIDDKIIKRANENGES---------.--------------------------------------------------------------------------------------------------------FVAMVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADN-----GDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVV------DDKRNPMDFVLWKMSKEGE...-PSWPSPWGAGRPGWHIECSAMNCKQLG.....NHFDIHGGGSDLMFPHHENEIAQSTCAHD-GQYVNYWMHSGMVMV----DREKMSKSLGNFFTVRDVLKYYDAETVRYFL.MSGHYRSQLNYSEENLKQARA
DSQ  GAATTTAAGCCTATTCACGCCGGGGAAGTCGGCATGTACGTGTGTGGAATCACCGTTTACGATCTCTGTCATATCGGTCACGGGCGTACCTTTGTTGCTTTTGACGTGGTTGCGCGCTATCTGCGTTTC---CTCGGCTATAAACTGAAGTATGTGCGCAACATTACCGATATCGACGACAAAATCATCAAACGCGCCAATGAAAATGGCGAAAGC---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTTGTGGCGATGGTGGATCGCATGATCGCCGAAATGCACAAAGATTTTGATGCTTTGAACATTCTGCGCCCGGATATGGAGCCGCGCGCGACGCACCATATCGCAGAAATTATTGAACTCACTGAACAACTGATCGCCAAAGGTCACGCTTATGTGGCGGACAAC---------------GGCGACGTGATGTTCGACGTCCCGACCGATCCAACTTATGGCGTGCTGTCGCGTCAGGATCTCGACCAGCTGCAGGCAGGCGCGCGCGTTGACGTGGTC------------------GACGACAAACGCAACCCAATGGACTTCGTTCTGTGGAAGATGTCGAAAGAGGGCGAA.........---CCGAGCTGGCCGTCTCCGTGGGGCGCGGGTCGTCCTGGCTGGCACATTGAATGTTCGGCAATGAACTGCAAGCAGCTGGGT...............AACCACTTTGATATCCACGGCGGCGGTTCAGACCTGATGTTCCCGCACCACGAAAACGAAATCGCGCAGTCCACCTGTGCCCATGAT---GGTCAGTATGTGAACTACTGGATGCACTCGGGGATGGTGATGGTT------------GACCGCGAGAAGATGTCCAAATCGCTGGGTAACTTCTTTACCGTGCGCGATGTGCTGAAATACTACGACGCGGAAACCGTGCGTTACTTCCTG...ATGTCGGGCCACTATCGCAGCCAGTTGAACTACAGCGAAGAGAACCTGAAGCAGGCGCGTGCG
TRN  11011101101011001
NAM  SYC_ARCFU/14-316
ASQ  LEDIVDGKRVKMYVCGITAYDYSHIGHARSAVFFDVFRRYLEY-LGYEVVYVQNFTDVDDKIINRAVKEGKT---------.--------------------------------------------------------------------------------------------------------QKEVAEKFIEEYLKDMEALNVKKPTYQPKVTEHIPDIIEFIQNLIEKGYAYVID------GDVYFHVPAFEHYGELSKQSLEELNRHRIEPD-------ERKRDVKDFALWKSAKEADlkaQAVFDSPWGRGRPGWHIECSVMSAKYLG.....VPFDIHGGGKDLIFPHHENERAQSFARFG-VEPVKIWVHNDFIRI----KGEKMSKSLGNIVRIRDVLQRYEGEVLRYFL.LTAHYRSPLDYTEEALERAKR
DSQ  CTTGAGGATATTGTGGATGGCAAAAGGGTGAAGATGTACGTTTGCGGTATCACAGCTTACGATTACTCCCACATCGGCCACGCGAGGAGTGCCGTGTTTTTCGACGTTTTCAGGAGGTATTTGGAGTAT---CTCGGATATGAGGTAGTATATGTTCAGAACTTCACGGATGTGGATGACAAGATCATCAACAGGGCCGTTAAGGAGGGCAAGACG---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CAGAAAGAAGTGGCGGAAAAGTTCATTGAGGAATATCTGAAGGACATGGAGGCTTTAAACGTAAAAAAGCCAACGTATCAGCCTAAGGTTACGGAGCACATCCCCGACATAATTGAGTTTATCCAGAATTTGATTGAAAAGGGCTACGCATACGTAATTGAT------------------GGGGATGTTTACTTCCACGTGCCAGCCTTTGAGCACTACGGCGAGCTATCGAAGCAAAGTCTTGAAGAGCTAAACAGGCACAGAATAGAGCCGGAT---------------------GAGAGGAAAAGGGACGTGAAGGATTTTGCCCTCTGGAAGTCCGCGAAAGAGGCTGATttaaaggctCAGGCTGTTTTCGACTCTCCTTGGGGCAGAGGAAGGCCGGGGTGGCACATAGAGTGCAGCGTCATGTCGGCCAAGTATCTGGGA...............GTGCCTTTCGACATCCACGGCGGGGGGAAGGACTTGATATTCCCCCACCACGAAAACGAGAGGGCTCAGAGCTTTGCGAGATTCGGG---GTGGAGCCTGTTAAAATCTGGGTGCACAACGACTTCATAAGGATA------------AAAGGGGAAAAGATGAGCAAAAGCCTGGGAAACATAGTCAGGATTAGGGATGTGCTTCAGAGGTACGAAGGAGAGGTGCTCAGATACTTTCTG...CTCACAGCCCACTACCGCAGCCCTCTCGACTACACCGAAGAGGCACTTGAGAGGGCGAAGAGG
TRN  10010101100011010
NAM  SYC_HELPY/13-317
ASQ  PFEPLVQNKANIYVCGPTVYDDAHLGHARSAIAFDLLRRTLEL-SGYEVMLVRNFTDIDDKIINKALKENKS---------.--------------------------------------------------------------------------------------------------------IQELSSIYIESYTRDLNALNVKKPSLEPKASEYLDAMVGMIETLLEKNIAYQVSN-----GDIYLDTSKDKDYGSLSVHNSS-IEFGRIGLVQ-------EKRLEQDFVLWKSYKGDN...DVGFDSPLGKGRPGWHIECSSMVFETLAltntpYQIDIHAGGADLLFPHHENEACQTRCAFG-VELAKYWMHNGFVNI----NNEKMSKSLGNSFFVKDALKNYDGEILRNYL.LGVHYRSVLNFNEEDLLVSKK
DSQ  CCTTTTGAGCCTTTAGTCCAAAATAAGGCGAATATTTATGTGTGCGGGCCTACGGTGTATGATGACGCTCATTTAGGGCATGCCAGGAGCGCGATTGCTTTTGATTTGTTAAGGCGCACGCTTGAATTG---AGCGGCTATGAAGTGATGCTAGTAAGGAATTTCACAGATATTGACGATAAGATCATCAACAAAGCCCTAAAAGAAAACAAAAGC---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ATTCAAGAATTAAGCAGCATTTATATTGAATCTTACACGAGGGATTTGAACGCTTTGAACGTGAAAAAACCCAGCCTAGAGCCTAAAGCGAGCGAGTATTTAGACGCTATGGTGGGCATGATTGAAACGCTTTTAGAAAAAAATATCGCTTATCAGGTCTCTAAT---------------GGGGATATTTATTTAGACACGAGCAAGGATAAAGATTACGGCTCTTTGAGCGTGCATAATAGCAGC---ATTGAATTTGGCCGTATTGGTTTGGTGCAA---------------------GAAAAACGGCTTGAGCAGGATTTTGTGTTATGGAAAAGCTATAAGGGGGATAAT.........GATGTGGGCTTTGATAGCCCTTTAGGCAAAGGGCGCCCTGGCTGGCATATAGAATGCTCTAGCATGGTTTTTGAAACTTTAGCGctcactaacacccccTATCAAATTGATATCCATGCAGGCGGAGCGGATTTGTTATTCCCCCACCATGAAAATGAAGCGTGCCAAACCCGTTGCGCCTTTGGC---GTGGAGCTTGCCAAATATTGGATGCATAACGGCTTTGTGAATATC------------AATAACGAAAAAATGTCTAAAAGTTTGGGGAATAGCTTTTTTGTTAAAGACGCTCTCAAAAACTATGATGGCGAAATTTTGCGCAATTACTTA...CTAGGGGTGCATTATCGCTCTGTTTTGAATTTCAATGAAGAAGACTTGTTAGTGAGTAAAAAA
TRN  10010101110011010
NAM  SYC_AZOBR/15-306
ASQ  RFEPMTPDRVGMYVCGPTVYDTAHIGNARP-VVFDLLFRLLRR-LYPAVTYVRNITASDDKIIDRRATTGAD------RGAdQAH-----------------------------------------------------------------------------------------------------RGPLPRRH--------GPLNAAP-TIEPRATHHISHMVALIGLLIEP--ATPTPR----KGTCCSPCRRWRSTGQLSRRSLDEMIAGARVEVA------PYKRDSSDFVLWKPSTDGQ...-PGWDSPWGRGRPGWHIECSAMAKEHLG.....VTFDIHGGGLDLILPDHENEIAQSRCAHAGEPLARYWVHQ---RLRDRRGARRMSKSLGNLL--------HRGTSCWTEFpGGGHPLGVRPYRSRGLPEAEE
NAM  SYC_MYCPN/17-310
ASQ  QSVVLEQKQINIYLCGPTVYNDLHLGNTRPLIVFDVLQRVLQA-AQYKVQFVQNITDIDDKIIKIAQQQEIS---------.--------------------------------------------------------------------------------------------------------EAQLCKQQITAYKSLLKKLNILP-IKHLQVTDKIDKMPGYIARLVKKGFAYVSPL-----GNTYFSVSQLPQYGILANRVVETIEDEATD-----------KRNKLDFVLWKQTTAG-...-VKWNSPWGWGRPGWHVECAFLIDYSFK.....DQLTIHGGGVDLKFPHHENENAMHMALYD-KPLTQHWMHIGHLMF----ENQKMSKSLQNFLLAVDFLTIHDFRILRWLF.YQKHYYHPLDLSQSLIEQACS
DSQ  CAGAGCGTGGTATTAGAACAAAAGCAAATTAACATTTATCTGTGTGGACCGACTGTTTACAATGATTTGCACCTAGGCAATACCCGTCCCTTAATTGTGTTTGATGTGCTACAAAGGGTGTTGCAAGCA---GCGCAGTACAAGGTGCAGTTTGTCCAAAACATCACTGATATTGACGACAAGATTATCAAGATCGCGCAGCAACAGGAAATTAGT---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GAAGCGCAGTTGTGCAAACAGCAAATCACCGCTTACAAAAGCTTGTTGAAAAAGCTCAACATTTTGCCG---ATTAAACACCTCCAAGTCACTGATAAAATTGACAAAATGCCCGGTTACATTGCCCGGTTAGTCAAAAAGGGCTTTGCTTACGTTTCGCCTTTG---------------GGCAACACGTACTTTAGTGTAAGCCAATTACCCCAGTATGGTATTTTAGCCAACCGTGTTGTGGAAACAATTGAGGATGAAGCTACTGAC---------------------------------AAACGCAATAAACTGGACTTTGTTTTGTGAAAACAAACGACCGCTGGG---.........---GTAAAGTGAAACAGTCCGTGAGGTTGGGGTCGGCCGGGTTGACACGTGGAGTGTGCCTTTTTAATTGATTACAGCTTTAAA...............GACCAGTTGACAATTCATGGTGGTGGGGTGGATTTGAAGTTTCCCCATCATGAAAACGAAAACGCAATGCATATGGCACTGTATGAC---AAACCATTAACGCAGCATTGGATGCACATTGGCCACTTAATGTTT------------GAAAACCAAAAGATGTCCAAGTCACTGCAAAACTTTCTTTTAGCAGTTGACTTTTTGACAATCCATGACTTTCGCATTTTGCGCTGATTGTTC...TATCAAAAACACTATTACCACCCGTTGGATTTAAGCCAATCTTTAATAGAGCAAGCTTGCAGT
TRN  00010000000000000
NAM  SYC_MYCGE/9-301
ASQ  KPTTLVQKTINIYLCGPTVYNDLHLGNTRPLIVFDVLNRVLKK-AKYTVNFVQNITDIDDKIIKIAQQQEVS---------.--------------------------------------------------------------------------------------------------------ESVVTKQQITAYKSLLKKLNILP-IKHIQITEKIDKIPDYIDQLVNQNHAYVSTQ-----NNVYFAVNSLKQYGYLANRMVH-LEETDTD-----------KKNKLDFVLWKITTAG-...-IKWNSKWGLGRPGWHVECAFLIDYCFK.....NELTIHGGGVDLKFPHHENENALHMALYN-QPITKHWMHIGHLMI----ENQKMSKSLQNFLLAVDFLNFHDFRVLRWIF.YQKHYLHPIDLNQSLIEKANN
DSQ  AAACCAACAACACTAGTTCAAAAAACCATTAACATTTATCTCTGTGGACCCACAGTTTATAACGATTTGCACTTAGGCAACACCAGACCATTAATTGTTTTTGATGTTTTAAATAGAGTTTTAAAAAAG---GCTAAATATACCGTTAATTTTGTTCAAAACATCACTGATATTGACGATAAGATCATCAAGATTGCTCAACAACAAGAAGTAAGC---------------------------...------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GAATCAGTTGTTACAAAACAACAAATCACTGCTTACAAATCACTTTTAAAAAAACTAAATATTCTGCCT---ATTAAACATATTCAAATCACTGAAAAAATCGATAAAATCCCTGACTATATTGATCAATTAGTAAATCAAAACCATGCTTATGTTTCAACTCAA---------------AACAACGTTTATTTTGCAGTTAATTCACTAAAGCAATATGGTTATCTAGCTAACCGAATGGTGCAT---TTAGAAGAAACTGATACTGAT---------------------------------AAAAAGAACAAATTGGATTTTGTACTTTGAAAGATTACTACTGCAGGG---.........---ATTAAATGAAATAGTAAGTGGGGACTTGGCAGACCAGGTTGACATGTTGAATGTGCCTTCTTAATTGATTATTGTTTCAAA...............AATGAACTCACGATCCACGGAGGAGGAGTTGATTTAAAGTTCCCCCACCATGAAAATGAAAATGCCTTACACATGGCTTTATATAAC---CAGCCCATTACCAAACATTGGATGCATATTGGTCATTTGATGATT------------GAAAACCAAAAGATGTCAAAGTCATTGCAGAACTTCTTGTTAGCAGTTGATTTTCTTAACTTTCATGATTTTCGTGTTTTGCGTTGGATCTTT...TACCAAAAACACTATTTGCATCCTATTGATCTAAACCAATCATTGATTGAAAAAGCTAATAAT
TRN  00010000000000000
//