EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01371 - Trp_repressor)
FAM  PF01371
PID  Trp_repressor
DES  Trp repressor protein
IPR  IPR000831
ANO  19
ALN  88
AID  0.332006
APH  ((((((Q7BVT7_BACSU/9-95:0.20027,Q92AP5_LISMO/9-95:0.31198):0.05520,Q8CRT7_STAEP/9-95:0.21611):0.08558,Q8ES89_OCEIH/9-95:0.23836):0.02220,((Q8XHZ0_CLOPE/11-97:0.14488,Q8RC44_THETN/9-95:0.18314):0.14900,Q97FQ3_CLOAB/11-97:0.16345):0.11316):0.68409,(((Q8EBT0_SHEON/3-90:0.71811,Q8KQD4_CHLTR/7-94:0.61845):0.03240,(((TRPR_ENTCL/17-104:0.10643,TRPR_YERPE/33-120:0.20063):0.27133,((TRPR_VIBVU/8-95:0.10488,TRPR_VIBCH/8-95:0.13336):0.06465,TRPR_VIBPA/8-95:0.13312):0.38411):0.08167,(TRPR_PASMU/8-95:0.08835,TRPR_HAEIN/8-95:0.19188):0.54895):0.30167):0.30966,TRPR_XYLFA/5-90:0.69616):0.92848):0.46722,Q8P9P4_XANCP/15-101:0.31920,Q87C27_XYLFT/15-101:0.09772);
ATP  ((((((Q7BVT7_BACSU/9-95,Q92AP5_LISMO/9-95),Q8CRT7_STAEP/9-95),Q8ES89_OCEIH/9-95),((Q8XHZ0_CLOPE/11-97,Q8RC44_THETN/9-95),Q97FQ3_CLOAB/11-97)),(((Q8EBT0_SHEON/3-90,Q8KQD4_CHLTR/7-94),(((TRPR_ENTCL/17-104,TRPR_YERPE/33-120),((TRPR_VIBVU/8-95,TRPR_VIBCH/8-95),TRPR_VIBPA/8-95)),(TRPR_PASMU/8-95,TRPR_HAEIN/8-95))),TRPR_XYLFA/5-90)),Q8P9P4_XANCP/15-101,Q87C27_XYLFT/15-101);
ATL  9.32348
DNO  18
DLN  264
DID  0.436278
DPH  ((Q8XHZ0_CLOPE/11-97:0.17500,Q8RC44_THETN/9-95:0.24432):0.06861,Q97FQ3_CLOAB/11-97:0.20446,(((Q7BVT7_BACSU/9-95:0.28174,(Q92AP5_LISMO/9-95:0.15829,((Q8P9P4_XANCP/15-101:0.24486,Q87C27_XYLFT/15-101:0.12466):0.38836,(((((TRPR_ENTCL/17-104:0.20448,TRPR_YERPE/33-120:0.24219):0.20068,(TRPR_VIBVU/8-95:0.17862,TRPR_VIBPA/8-95:0.25329):0.21694):0.14730,(TRPR_PASMU/8-95:0.15291,TRPR_HAEIN/8-95:0.22080):0.28003):0.12365,(Q8KQD4_CHLTR/7-94:0.32760,TRPR_XYLFA/5-90:0.62962):0.25537):0.15309,Q8EBT0_SHEON/3-90:0.46567):0.27450):0.36697):0.08239):0.11414,Q8CRT7_STAEP/9-95:0.19858):0.07212,Q8ES89_OCEIH/9-95:0.21602):0.11969);
DTP  ((Q8XHZ0_CLOPE/11-97,Q8RC44_THETN/9-95),Q97FQ3_CLOAB/11-97,(((Q7BVT7_BACSU/9-95,(Q92AP5_LISMO/9-95,((Q8P9P4_XANCP/15-101,Q87C27_XYLFT/15-101),(((((TRPR_ENTCL/17-104,TRPR_YERPE/33-120),(TRPR_VIBVU/8-95,TRPR_VIBPA/8-95)),(TRPR_PASMU/8-95,TRPR_HAEIN/8-95)),(Q8KQD4_CHLTR/7-94,TRPR_XYLFA/5-90)),Q8EBT0_SHEON/3-90)))),Q8CRT7_STAEP/9-95),Q8ES89_OCEIH/9-95));
DTL  7.38695
RID  0.33038
RPH  ((((((Q7BVT7_BACSU/9-95:0.19972,Q92AP5_LISMO/9-95:0.31022):0.05480,Q8CRT7_STAEP/9-95:0.21451):0.08564,Q8ES89_OCEIH/9-95:0.23731):0.02226,((Q8XHZ0_CLOPE/11-97:0.14445,Q8RC44_THETN/9-95:0.18292):0.14823,Q97FQ3_CLOAB/11-97:0.16345):0.11252):0.65743,(((Q8EBT0_SHEON/3-90:0.69629,Q8KQD4_CHLTR/7-94:0.64359):0.03666,(((TRPR_ENTCL/17-104:0.11207,TRPR_YERPE/33-120:0.19369):0.25778,(TRPR_PASMU/8-95:0.08317,TRPR_HAEIN/8-95:0.19535):0.59321):0.10039,(TRPR_VIBVU/8-95:0.15282,TRPR_VIBPA/8-95:0.12910):0.33677):0.28352):0.30348,TRPR_XYLFA/5-90:0.71064):0.89346):0.48112,Q8P9P4_XANCP/15-101:0.31220,Q87C27_XYLFT/15-101:0.10269);
RTP  ((((((Q7BVT7_BACSU/9-95,Q92AP5_LISMO/9-95),Q8CRT7_STAEP/9-95),Q8ES89_OCEIH/9-95),((Q8XHZ0_CLOPE/11-97,Q8RC44_THETN/9-95),Q97FQ3_CLOAB/11-97)),(((Q8EBT0_SHEON/3-90,Q8KQD4_CHLTR/7-94),(((TRPR_ENTCL/17-104,TRPR_YERPE/33-120),(TRPR_PASMU/8-95,TRPR_HAEIN/8-95)),(TRPR_VIBVU/8-95,TRPR_VIBPA/8-95))),TRPR_XYLFA/5-90)),Q8P9P4_XANCP/15-101,Q87C27_XYLFT/15-101);
RTL  9.12097
LNK  Q7BVT7_BACSU/9-95:Q7BVT7:AF011544
LNK  Q87C27_XYLFT/15-101:Q87C27:AE012557
LNK  Q8CRT7_STAEP/9-95:Q8CRT7:AE016749
LNK  Q8EBT0_SHEON/3-90:Q8EBT0:AE015778
LNK  Q8ES89_OCEIH/9-95:Q8ES89:BA000028
LNK  Q8KQD4_CHLTR/7-94:Q8KQD4:AY096817
LNK  Q8P9P4_XANCP/15-101:Q8P9P4:AE012283
LNK  Q8RC44_THETN/9-95:Q8RC44:AE013029
LNK  Q8XHZ0_CLOPE/11-97:Q8XHZ0:BA000016
LNK  Q92AP5_LISMO/9-95:Q92AP5:AL591981
LNK  Q97FQ3_CLOAB/11-97:Q97FQ3:AE007765
LNK  TRPR_ENTCL/17-104:P39440:L26583
LNK  TRPR_HAEIN/8-95:P44889:U32765
LNK  TRPR_PASMU/8-95:Q9CNU9:AE006068
LNK  TRPR_VIBCH/8-95:Q9KU28:
LNK  TRPR_VIBPA/8-95:Q87S71:AP005074
LNK  TRPR_VIBVU/8-95:Q8DEU5:AE016798
LNK  TRPR_XYLFA/5-90:Q9PC61:AE004011
LNK  TRPR_YERPE/33-120:P58700:AJ414142
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  TRPR_XYLFA/5-90
ASQ  QAFEMLIKILCKTDSTDDMKLILECILTRSEMEDLIDRIRIYNELLNTNNSQREVASKLGVSITKITRGAANLQ--DNNIKDFLRKKI
DSQ  CAAGCATTTGAAATGCTGATTAAAATTTTGTGTAAGACAGATTCTACTGACGATATGAAACTCATTTTGGAGTGCATTCTAACTAGGAGCGAAATGGAGGACCTCATTGACCGTATTCGTATCTATAATGAGCTTCTAAACACTAACAACTCACAACGTGAAGTTGCCAGTAAACTAGGAGTAAGCATTACAAAGATAACAAGAGGAGCAGCCAATCTTCAG------GATAATAATATAAAAGATTTTCTTAGAAAAAAAATA
TRN  10010101100011001
NAM  Q8EBT0_SHEON/3-90
ASQ  ANWDLVLEKILSHGNYEELSVLFHLLLTEEERSAIAGRLKVFQLLLNGEMSQRQIAAEYQVSIATITRCSNYLKNMAPSHRDKIQQLI
DSQ  GCCAATTGGGACTTAGTATTAGAAAAAATTTTGAGCCATGGGAATTATGAAGAGCTGTCGGTATTATTCCATTTATTGCTGACAGAGGAAGAGCGCAGCGCTATTGCCGGTCGGCTAAAAGTGTTTCAGCTATTGCTAAATGGAGAAATGAGCCAAAGGCAAATTGCAGCCGAGTATCAGGTGAGTATTGCGACCATTACCCGTTGTTCTAACTATTTAAAGAATATGGCACCAAGTCATAGGGATAAAATCCAACAACTCATC
TRN  10010101100011010
NAM  Q8KQD4_CHLTR/7-94
ASQ  SGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALKGLDPQFKEFLPKEI
DSQ  TCTGGCTGGCAAGCTTTTCTGACATTATGCTCTAAAATGCAAAAAGAAAAGTTTTTACAAGACCTTTTTTCGCTGTTTTTGTCTTTTAGCGAACGTAAAGATGTCGCTTCTCGCTATCATATCATTCGAGCTCTTTTAGAAGGGGAGCTCACTCAAAGAGAGATAGCAGAGAAATACGGAGTCAGTATCGCACAAATTACCAGAGGATCTAATGCCCTTAAAGGATTAGATCCTCAATTTAAAGAGTTTTTACCAAAAGAGATC
TRN  10010101100011010
NAM  TRPR_HAEIN/8-95
ASQ  EQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLIDKNMPQREIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHL
DSQ  GAGCAATGGAATGCATTTCTTCAAATGCTAAAAATTGCCTTTGAAGAAAACAAAGCGCAGGAATTTCTAACCTTATTATTAACTGCAGACGAACGAGATGCTGTAGGATTACGCTTGCAGATTGTCTCTCAGCTGATTGATAAAAATATGCCTCAGCGTGAAATTCAACAAAATCTGAATACAAGTGCCGCCACAATCACTCGAGGTTCCAATATGATTAAAACGATGGATCCTGATTTTATGCAATGGATGAAACAACATCTT
TRN  11011101101011010
NAM  TRPR_PASMU/8-95
ASQ  EQWHAFVEMLRTAFAQGKEQEILTLLLTPDERDSVGLRLQIVAQLLDKSVPQREIQQNLNTSAATITRGSNMIKTMPPEFMAWVKEQL
DSQ  GAACAATGGCATGCTTTCGTCGAAATGTTACGCACCGCATTCGCCCAAGGCAAAGAGCAGGAAATCTTAACTCTCTTGCTCACCCCTGACGAACGAGACTCCGTCGGACTACGCTTACAAATTGTCGCTCAATTATTAGATAAAAGCGTACCCCAACGCGAAATTCAGCAAAATCTCAATACCAGCGCAGCCACCATTACTCGTGGCTCAAATATGATTAAAACCATGCCACCTGAATTTATGGCGTGGGTAAAAGAACAATTA
TRN  11011101111011000
NAM  TRPR_VIBPA/8-95
ASQ  RDWQQIVELIRSSVDSQQHEMLLTMLMTPDERESLTARVNILNELLKGELSQRQISQMLGVGIATITRGSNELKSKSEAEKDKLKLLL
DSQ  AGAGACTGGCAACAGATTGTCGAGCTAATCCGATCCAGCGTGGATAGCCAGCAACATGAGATGTTGTTAACCATGCTGATGACACCTGATGAGAGGGAATCATTAACTGCACGCGTTAACATTCTTAATGAGCTTCTCAAAGGGGAATTATCTCAACGTCAGATCAGTCAGATGCTTGGTGTTGGCATTGCTACGATCACTCGTGGCTCAAATGAGTTGAAGTCGAAATCCGAAGCGGAAAAAGACAAGCTGAAACTCTTATTA
TRN  10010101100011000
NAM  TRPR_VIBCH/8-95
ASQ  SEWQQVLDLVKQAVQQEQHEMLLTMLMTPDEREALVARVNIVHELLQGELSQRQISQMLGVGIATITRGSNELKSRSEDEKAALAQLL
NAM  TRPR_VIBVU/8-95
ASQ  TDWQQIVDLVKHSVEQKQHDMLLTMLMTPDEREALVSRVNIVRELLKGELSQRQISQMLGVGIATITRGSNELKLKSDEDKARLNQLL
DSQ  ACAGACTGGCAACAAATTGTGGATTTGGTCAAGCACAGTGTCGAACAAAAGCAGCATGATATGTTATTGACGATGCTGATGACGCCTGACGAACGTGAAGCTTTAGTGTCTAGAGTGAACATCGTTCGTGAGTTATTGAAAGGCGAGCTTTCCCAGCGACAAATCAGCCAAATGTTGGGCGTTGGTATTGCGACCATTACTCGAGGTTCCAATGAGCTGAAGTTAAAGTCAGATGAAGATAAAGCGCGCTTGAATCAGTTATTG
TRN  10010101100011000
NAM  TRPR_YERPE/33-120
ASQ  QHWLSFVALLQNAITQDLHLPLLQLMLTPDERTALGTRVRIIEELMRGELSQRELKSQLGAGIATITRGSNSLKTAPPQLKSWLEAQL
DSQ  CAGCACTGGTTGAGCTTTGTCGCGCTGTTGCAAAACGCGATTACACAAGATCTTCATCTGCCTTTACTGCAACTGATGCTAACACCTGATGAGCGAACCGCCTTGGGGACGCGTGTGCGCATTATTGAAGAGTTAATGCGCGGTGAGCTAAGCCAGCGTGAGCTGAAAAGTCAGTTGGGTGCAGGTATTGCGACGATCACCCGTGGCTCTAATAGCTTGAAAACGGCCCCACCACAGCTGAAAAGCTGGCTCGAAGCCCAGTTG
TRN  11011101101011010
NAM  TRPR_ENTCL/17-104
ASQ  QEWLRFVELLRQSYDKDLHLPLLQLMLTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSLKSAPVELRQWLEQIL
DSQ  CAGGAGTGGCTTCGTTTTGTGGAGTTGCTCCGCCAGTCTTATGACAAGGATCTGCATCTACCGCTATTACAGCTTATGCTGACGCCCGATGAACGCGAAGCGCTGGGCACGCGGGTACGCATTATTGAAGAGCTGCTGCGCGGCGAAATGAGCCAGCGCGAGCTGAAAAACGAGCTAGGCGCGGGCATTGCGACAATCACCCGCGGATCGAATAGCCTGAAATCTGCGCCGGTTGAGCTGCGCCAGTGGCTGGAGCAGATCCTC
TRN  11011101101011010
NAM  Q87C27_XYLFT/15-101
ASQ  AALQALADALACLRNSATVLAFLRDLCTPAELEALADRWRVVP-LLLQGRPYRDIHDHTGISVTTIGRVARCLEHGTGGYAAVLQAQA
DSQ  GCTGCATTACAGGCATTAGCCGACGCCCTTGCCTGCCTTAGAAACAGCGCCACAGTCCTTGCCTTTCTCCGTGACCTGTGTACCCCAGCCGAGTTGGAAGCGCTGGCCGACCGCTGGCGCGTCGTGCCC---TTGCTGCTCCAAGGCCGGCCCTACCGTGACATCCACGACCACACCGGCATCAGCGTCACCACCATCGGCCGTGTCGCGCGTTGCCTTGAACACGGTACCGGCGGCTATGCAGCGGTATTGCAGGCCCAGGCC
TRN  10010101100011010
NAM  Q8P9P4_XANCP/15-101
ASQ  ASLKMLSEALACLEAPGAVEAFLRDLCTPAELEAMSDRWRVVP-LLVKGVPYREIHDLTQVSVTTIGRVARTLEHGAGGYAAALREQS
DSQ  GCCTCGCTGAAGATGCTGTCCGAGGCACTGGCCTGCCTGGAGGCGCCCGGCGCCGTCGAGGCCTTCCTGCGTGACCTGTGCACGCCGGCCGAACTCGAAGCCATGTCCGACCGCTGGCGGGTGGTGCCG---TTGCTGGTCAAGGGCGTGCCGTATCGCGAGATCCATGACCTGACCCAGGTCAGCGTCACCACCATCGGGCGTGTCGCGCGCACCCTGGAACACGGCGCCGGCGGCTATGCCGCGGCCCTGCGCGAGCAATCG
TRN  11011111101111111
NAM  Q8RC44_THETN/9-95
ASQ  KLVDQLFEAILKLKNIEECYRFFEDIATINEIKALAQRLEVAR-MLRQKKTYIEIAEKTGASTATISRVNRALNYGANGYKIILERLE
DSQ  AAGCTGGTAGACCAGCTTTTTGAGGCCATTTTAAAGCTTAAGAACATAGAGGAATGTTACAGGTTTTTTGAAGATATTGCTACTATAAATGAGATAAAAGCTTTAGCTCAGAGATTGGAAGTTGCTAGA---ATGCTAAGACAAAAGAAGACCTATATAGAGATTGCAGAAAAAACAGGGGCTAGTACTGCCACGATAAGTAGAGTGAACAGGGCATTGAATTATGGCGCAAATGGATATAAAATTATATTGGAAAGGTTGGAA
TRN  10010101100011010
NAM  Q8XHZ0_CLOPE/11-97
ASQ  KDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAK-MLREKKTYTEIAEETKASTATISRVNRCLNYGADGYNNILNRLD
DSQ  AAGGATTTAGATTTTTTATTTGAGGCTATATTAAAGTTAGAAGATATAAATGAATGTTATAATTTTTTTGAAGATATATGCACTATTTCAGAGCTAAAAGCATTAGCGCAAAGATTACATGTTGCAAAA---ATGCTTAGGGAGAAAAAAACATATACTGAAATTGCAGAAGAGACTAAGGCTTCAACAGCTACTATAAGTAGAGTAAATAGATGTTTAAACTATGGAGCAGATGGTTACAACAATATCTTAAATAGATTAGAT
TRN  10010101110011000
NAM  Q97FQ3_CLOAB/11-97
ASQ  ETLDFLCDAILTLENREECYRFFDDIFTINEIKTIEQRLQVAK-MLKEKHTYSDISAETGASTATISRVNRCINYGSDGYNIVLRRLE
DSQ  GAGACTCTGGATTTCTTGTGTGATGCCATATTAACATTAGAGAATCGAGAAGAATGCTATAGGTTTTTTGATGATATTTTTACTATCAATGAAATTAAAACTATAGAACAAAGGCTTCAAGTGGCTAAG---ATGCTTAAGGAGAAACATACATATTCAGATATTTCCGCGGAAACTGGAGCTAGTACTGCAACCATAAGTAGAGTTAATAGATGTATTAATTATGGAAGCGATGGATATAATATAGTTTTAAGAAGACTAGAA
TRN  10010101100011000
NAM  Q8ES89_OCEIH/9-95
ASQ  EQLDLLFDAILSLKDKEECYKFFDDIATMSEVQSLSQRFQVAK-MLTEGNTYSAIEKETKASTATISRVRRCINYGSDGYNLVLERMN
DSQ  GAGCAATTAGATCTTTTGTTTGATGCTATTCTATCGTTAAAAGACAAAGAAGAATGCTATAAATTTTTTGATGATATTGCTACGATGTCAGAAGTTCAATCATTGTCGCAACGATTTCAAGTAGCGAAA---ATGCTAACGGAAGGAAATACGTATAGTGCAATTGAGAAGGAAACAAAAGCATCTACTGCGACAATCTCTAGAGTAAGACGTTGTATTAACTATGGTAGTGACGGATACAACTTAGTATTAGAACGAATGAAT
TRN  10010101110011000
NAM  Q92AP5_LISMO/9-95
ASQ  QGLDEFFQGILTLENLEECYAFFDDVCTVNEIQSMAQRFQVAK-MLHDGKTYNVIESETGASTATISRVKRSLHYGNDMYDVVFSRMT
DSQ  CAAGGATTGGATGAATTCTTCCAAGGGATTTTAACCCTCGAGAATTTAGAAGAATGTTATGCTTTTTTTGATGATGTTTGTACAGTGAATGAAATACAGTCCATGGCTCAACGTTTCCAAGTAGCAAAA---ATGCTTCATGATGGAAAAACATACAATGTGATTGAATCAGAAACTGGGGCAAGTACAGCAACCATTTCACGTGTAAAACGCTCGCTTCATTATGGCAATGATATGTATGATGTTGTATTTTCAAGAATGACG
TRN  10010101110011000
NAM  Q8CRT7_STAEP/9-95
ASQ  QSLDELFDAILALENREECYQFFDDLCTVNEIQSLSQRLQVAK-MIKQGYTYATIEEESGASTATISRVKRSLQWGNDAYTMILDRLN
DSQ  CAGTCATTAGATGAATTATTTGATGCGATCTTAGCACTAGAAAACAGAGAAGAATGTTATCAGTTTTTCGATGATTTATGTACTGTAAATGAAATACAGTCATTATCTCAGAGACTTCAAGTTGCTAAA---ATGATTAAGCAAGGTTATACTTATGCAACTATTGAAGAAGAGTCTGGTGCATCGACTGCAACGATTTCTAGAGTAAAGCGTTCGTTACAATGGGGTAATGATGCTTATACAATGATTTTGGATAGACTAAAT
TRN  10010101110011000
NAM  Q7BVT7_BACSU/9-95
ASQ  KELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVAR-MLREGNTYHKIETETGASTATISRVKRCLNYGNDAYEMALDRVK
DSQ  AAAGAGCTGGACCAGTTATTTAACTCGATCTTATCGCTGAAAGACCTGGAGGAATGTTACCGATTCTTCGATGATCTATGCACAATTAACGAAATTCAATCGCTGGCTCAGCGCCTTGAAGTGGCGCGC---ATGCTTCGCGAAGGAAACACGTATCATAAGATTGAAACAGAAACAGGCGCTTCCACGGCTACGATTTCCCGTGTGAAACGCTGCTTAAATTACGGAAATGACGCTTATGAAATGGCGCTTGACCGTGTGAAG
TRN  11011101101011010
//