EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01353 - GFP)
FAM  PF01353
PID  GFP
DES  Green fluorescent protein
IPR  IPR011584
ANO  28
ALN  242
AID  0.501659
APH  ((((((((((Q8T5F0_9CNID/7-229:0.16361,Q8T5F3_9CNID/6-223:0.09418):0.28237,Q8MU46_RICFL/1-221:0.32397):0.07241,((Q95UA7_9CNID/1-218:0.17833,Q963F5_9CNID/1-218:0.06852):0.05209,((Q95VT0_9CNID/1-221:0.07952,Q8MU48_9CNID/1-218:0.16040):0.03227,(Q8I6J8_9CNID/1-219:0.15817,Q8T5F1_9CNID/1-219:0.10005):0.06844):0.05372):0.03283):0.01459,(Q8T6U0_9CNID/3-219:0.13041,GLCP_CLASP/43-260:0.13382):0.04591):0.10896,(Q8MMA1_9CNID/12-234:0.16285,Q8MMA2_9CNID/34-254:0.09953):0.31026):0.03962,((NFCP_GONTE/1-218:0.20346,Q9GTJ7_9CNID/5-223:0.28872):0.05194,GLCP_DISST/5-223:0.30522):0.17270):0.04263,(Q8T4U4_9CNID/5-228:0.55351,GLCP_ANEMA/5-224:0.31337):0.19286):0.06954,(GFP_AEQVI/5-229:1.58638,((DSRD_PARAC/2-222:0.22557,(NFCP_CONPS/2-220:0.22576,Q9GPI5_ANESU/2-222:0.19377):0.17485):0.14118,((Q8T6T9_RADMA/2-220:0.15815,Q8T5E7_CONGI/2-220:0.14310):0.05898,Q9GPI6_ANESU/2-219:0.12130):0.21648):0.10347):0.07650):0.38329,Q963I9_RENRE/5-223:0.34049):0.18396,Q9BLY9_9CNID/8-225:0.10916,Q9BLZ0_9CNID/8-225:0.15310);
ATP  ((((((((((Q8T5F0_9CNID/7-229,Q8T5F3_9CNID/6-223),Q8MU46_RICFL/1-221),((Q95UA7_9CNID/1-218,Q963F5_9CNID/1-218),((Q95VT0_9CNID/1-221,Q8MU48_9CNID/1-218),(Q8I6J8_9CNID/1-219,Q8T5F1_9CNID/1-219)))),(Q8T6U0_9CNID/3-219,GLCP_CLASP/43-260)),(Q8MMA1_9CNID/12-234,Q8MMA2_9CNID/34-254)),((NFCP_GONTE/1-218,Q9GTJ7_9CNID/5-223),GLCP_DISST/5-223)),(Q8T4U4_9CNID/5-228,GLCP_ANEMA/5-224)),(GFP_AEQVI/5-229,((DSRD_PARAC/2-222,(NFCP_CONPS/2-220,Q9GPI5_ANESU/2-222)),((Q8T6T9_RADMA/2-220,Q8T5E7_CONGI/2-220),Q9GPI6_ANESU/2-219)))),Q963I9_RENRE/5-223),Q9BLY9_9CNID/8-225,Q9BLZ0_9CNID/8-225);
ATL  9.80059
DNO  22
DLN  726
DID  0.574833
DPH  (((((((((Q963F5_9CNID/1-218:0.06666,(Q95VT0_9CNID/1-221:0.05494,(Q8I6J8_9CNID/1-219:0.13032,Q8T5F1_9CNID/1-219:0.05703):0.03519):0.02923):0.01348,Q95UA7_9CNID/1-218:0.08454):0.02709,(Q8T6U0_9CNID/3-219:0.10553,GLCP_CLASP/43-260:0.09997):0.06373):0.07326,Q8MMA2_9CNID/34-254:0.22181):0.06268,(GFP_AEQVI/5-229:0.90671,(Q8T4U4_9CNID/5-228:0.35127,GLCP_ANEMA/5-224:0.21027):0.09866):0.10173):0.05256,(NFCP_GONTE/1-218:0.13895,(Q9GTJ7_9CNID/5-223:0.14682,GLCP_DISST/5-223:0.15677):0.03402):0.11009):0.10742,((DSRD_PARAC/2-222:0.19900,(NFCP_CONPS/2-220:0.14208,Q9GPI5_ANESU/2-222:0.11513):0.15455):0.07713,(Q8T6T9_RADMA/2-220:0.14401,Q9GPI6_ANESU/2-219:0.09035):0.17586):0.10550):0.26427,Q963I9_RENRE/5-223:0.26374):0.15984,Q9BLY9_9CNID/8-225:0.20226,Q9BLZ0_9CNID/8-225:0.15768);
DTP  (((((((((Q963F5_9CNID/1-218,(Q95VT0_9CNID/1-221,(Q8I6J8_9CNID/1-219,Q8T5F1_9CNID/1-219))),Q95UA7_9CNID/1-218),(Q8T6U0_9CNID/3-219,GLCP_CLASP/43-260)),Q8MMA2_9CNID/34-254),(GFP_AEQVI/5-229,(Q8T4U4_9CNID/5-228,GLCP_ANEMA/5-224))),(NFCP_GONTE/1-218,(Q9GTJ7_9CNID/5-223,GLCP_DISST/5-223))),((DSRD_PARAC/2-222,(NFCP_CONPS/2-220,Q9GPI5_ANESU/2-222)),(Q8T6T9_RADMA/2-220,Q9GPI6_ANESU/2-219))),Q963I9_RENRE/5-223),Q9BLY9_9CNID/8-225,Q9BLZ0_9CNID/8-225);
DTL  5.79213
RID  0.495395
RPH  ((((((((Q8T6U0_9CNID/3-219:0.14111,GLCP_CLASP/43-260:0.12620):0.04139,((Q95UA7_9CNID/1-218:0.17448,Q963F5_9CNID/1-218:0.07194):0.04286,(Q95VT0_9CNID/1-221:0.10102,(Q8I6J8_9CNID/1-219:0.15398,Q8T5F1_9CNID/1-219:0.10286):0.06829):0.06277):0.03413):0.10991,Q8MMA2_9CNID/34-254:0.39680):0.05399,((NFCP_GONTE/1-218:0.20293,Q9GTJ7_9CNID/5-223:0.29020):0.04785,GLCP_DISST/5-223:0.30439):0.16409):0.04596,(Q8T4U4_9CNID/5-228:0.54694,GLCP_ANEMA/5-224:0.31585):0.19357):0.07331,(GFP_AEQVI/5-229:1.57578,((DSRD_PARAC/2-222:0.22920,(NFCP_CONPS/2-220:0.22204,Q9GPI5_ANESU/2-222:0.19702):0.16839):0.13341,(Q8T6T9_RADMA/2-220:0.19393,Q9GPI6_ANESU/2-219:0.12989):0.22010):0.10982):0.07231):0.39237,Q963I9_RENRE/5-223:0.34227):0.18264,Q9BLY9_9CNID/8-225:0.10916,Q9BLZ0_9CNID/8-225:0.15261);
RTP  ((((((((Q8T6U0_9CNID/3-219,GLCP_CLASP/43-260),((Q95UA7_9CNID/1-218,Q963F5_9CNID/1-218),(Q95VT0_9CNID/1-221,(Q8I6J8_9CNID/1-219,Q8T5F1_9CNID/1-219)))),Q8MMA2_9CNID/34-254),((NFCP_GONTE/1-218,Q9GTJ7_9CNID/5-223),GLCP_DISST/5-223)),(Q8T4U4_9CNID/5-228,GLCP_ANEMA/5-224)),(GFP_AEQVI/5-229,((DSRD_PARAC/2-222,(NFCP_CONPS/2-220,Q9GPI5_ANESU/2-222)),(Q8T6T9_RADMA/2-220,Q9GPI6_ANESU/2-219)))),Q963I9_RENRE/5-223),Q9BLY9_9CNID/8-225,Q9BLZ0_9CNID/8-225);
RTL  8.322
LNK  DSRD_PARAC/2-222:Q8ISF8:AY130757
LNK  GFP_AEQVI/5-229:P42212:M62653
LNK  GLCP_ANEMA/5-224:Q9U6Y6:AF168421
LNK  GLCP_CLASP/43-260:Q9U6Y3:AF168424
LNK  GLCP_DISST/5-223:Q9U6Y7:AF168420
LNK  NFCP_CONPS/2-220:Q95W11:AF383155
LNK  NFCP_GONTE/1-218:Q95P04:AF383156
LNK  Q8I6J8_9CNID/1-219:Q8I6J8:AB085641
LNK  Q8MMA1_9CNID/12-234:Q8MMA1:
LNK  Q8MMA2_9CNID/34-254:Q8MMA2:AY037765
LNK  Q8MU46_RICFL/1-221:Q8MU46:
LNK  Q8MU48_9CNID/1-218:Q8MU48:
LNK  Q8T4U4_9CNID/5-228:Q8T4U4:AY059642
LNK  Q8T5E7_CONGI/2-220:Q8T5E7:
LNK  Q8T5F0_9CNID/7-229:Q8T5F0:
LNK  Q8T5F1_9CNID/1-219:Q8T5F1:AY037770
LNK  Q8T5F3_9CNID/6-223:Q8T5F3:
LNK  Q8T6T9_RADMA/2-220:Q8T6T9:AF420592
LNK  Q8T6U0_9CNID/3-219:Q8T6U0:AF420591
LNK  Q95UA7_9CNID/1-218:Q95UA7:AY056460
LNK  Q95VT0_9CNID/1-221:Q95VT0:AF406766
LNK  Q963F5_9CNID/1-218:Q963F5:AF384683
LNK  Q963I9_RENRE/5-223:Q963I9:AF372525
LNK  Q9BLY9_9CNID/8-225:Q9BLY9:AY015996
LNK  Q9BLZ0_9CNID/8-225:Q9BLZ0:AY015995
LNK  Q9GPI5_ANESU/2-222:Q9GPI5:AF322222
LNK  Q9GPI6_ANESU/2-219:Q9GPI6:AF322221
LNK  Q9GTJ7_9CNID/5-223:Q9GTJ7:AF272711
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxx...xxx.....xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxx.xxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxx...............xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GLCP_DISST/5-223
ASQ  KSVIKEEMLIDLHLEGTFNGHYFEIKGKGKGQPNEGTN..TVTLEVTKGGPLPFGWHILCPQFQYGNKAFVHHPDNI..HDYLKLSFPE--.GYTWERSMHFEDGGLCCITNDISL...TGN.....CFYYDIKFTGLNFPPNGPVVQKKTT-GWEP.STERLYP-.RDGVLIGDIHHALT.VEGGGHYACDIKTVYRAKKAALKM.-PGYHYVDTKLVIWNNDK.EFMKVEEHEIAVARHH
DSQ  AAGAGTGTGATCAAGGAAGAAATGTTGATCGATCTTCATCTGGAAGGAACGTTCAATGGGCACTACTTTGAAATAAAAGGCAAAGGAAAAGGACAGCCTAATGAAGGCACCAAT......ACCGTCACGCTCGAGGTTACCAAGGGTGGACCTCTGCCATTTGGTTGGCATATTTTGTGCCCACAATTTCAGTATGGAAACAAGGCATTTGTCCACCACCCTGACAACATA......CATGATTATCTAAAGCTGTCATTTCCGGAG------...GGATATACATGGGAACGGTCCATGCACTTTGAAGACGGTGGCTTGTGTTGTATCACCAATGATATCAGTTTG.........ACAGGCAAC...............TGTTTCTACTACGACATCAAGTTCACTGGCTTGAACTTTCCTCCAAATGGACCCGTTGTGCAGAAGAAGACAACT---GGCTGGGAACCG...AGCACTGAGCGTTTGTATCCT---...CGTGATGGTGTGTTGATAGGAGACATCCATCATGCTCTGACA...GTTGAAGGAGGTGGTCATTACGCATGTGACATTAAAACTGTTTACAGGGCCAAGAAGGCCGCCTTGAAGATG...---CCAGGGTATCACTATGTTGACACCAAACTGGTTATATGGAACAACGACAAA...GAATTCATGAAAGTTGAGGAGCATGAAATCGCCGTTGCACGCCACCAT
TRN  10010101100011001
NAM  Q9GTJ7_9CNID/5-223
ASQ  KNVIKEFMRFKVRMEGTVNGHEFEIKGEGEGRPYEGHC..SVKLMVTKGGPLPFAFDILSPQFQYGSKVYVKHPADI..PDYKKLSFPE--.GFKWERVMNFEDGGVVTVSQDSSL...KDG.....CFIYEVKFIGVNFPSDGPVMQRRTR-GWEA.SSERLYP-.RDGVLKGDIHMALR.LEGGGHYLVEFKSIYMVKKPSVQL.-PGYYYVDSKLDMTSHNE.DYTVVEQYEKTQGRHH
DSQ  AAGAATGTGATCAAGGAGTTCATGAGGTTCAAGGTTCGTATGGAAGGAACGGTCAATGGGCACGAGTTTGAAATAAAAGGCGAAGGTGAAGGGAGGCCTTACGAAGGTCACTGT......TCCGTAAAGCTTATGGTAACCAAGGGTGGACCTTTGCCATTTGCTTTTGATATTTTGTCACCACAATTTCAGTATGGAAGCAAGGTATATGTCAAACACCCTGCCGACATA......CCAGACTATAAAAAGCTGTCATTTCCTGAG------...GGATTTAAATGGGAAAGGGTCATGAACTTTGAAGACGGTGGCGTGGTTACTGTATCCCAAGATTCCAGTTTG.........AAAGACGGC...............TGTTTCATCTACGAGGTCAAGTTCATTGGGGTGAACTTTCCTTCTGATGGACCTGTTATGCAGAGGAGGACACGG---GGCTGGGAAGCC...AGCTCTGAGCGTTTGTATCCT---...CGTGATGGGGTGCTGAAAGGAGACATCCATATGGCTCTGAGG...CTGGAAGGAGGCGGCCATTACCTCGTTGAATTCAAAAGTATTTACATGGTAAAGAAGCCTTCAGTGCAGTTG...---CCAGGCTACTATTATGTTGACTCCAAACTGGATATGACGAGCCACAACGAA...GATTACACAGTCGTTGAGCAGTATGAAAAAACCCAGGGACGCCACCAT
TRN  10010101100011001
NAM  NFCP_GONTE/1-218
ASQ  MSVIAKQMTYKVYMSGTVNGHYFEVQGDGKGKPYEGEQ..TVKLTVTKGGPLPFAWDILSPQSQYGSIPFTKYPEDI..PDYVKQSFPE--.GYTWERIMNFEDGAVCTVSNDSSI...QGN.....CFIYNVKFSGLNFPPNGPVMQKKTQ-GWEP.NTERLFA-.RDGMLIGNNFMALK.LEGGGHYLCEFKSTYKAKKP-VKM.-PGYHYVDRKLDVTNHNI.DYTSVEQCEISIARKP
DSQ  ATGAGTGTGATCGCTAAACAAATGACCTACAAGGTTTATATGTCAGGCACGGTCAATGGACACTACTTTGAGGTCCAAGGCGATGGAAAAGGAAAGCCTTACGAGGGGGAGCAG......ACGGTAAAGCTCACTGTCACCAAGGGTGGACCTCTGCCATTTGCTTGGGATATTTTATCACCACAGTCTCAGTACGGAAGCATACCATTCACCAAGTACCCTGAAGACATC......CCTGACTATGTAAAGCAGTCATTCCCTGAG------...GGATATACATGGGAGAGGATCATGAACTTTGAAGATGGTGCAGTGTGTACTGTCAGCAATGATTCCAGCATC.........CAAGGCAAC...............TGTTTCATCTACAATGTCAAGTTCTCTGGTTTGAACTTTCCTCCCAATGGACCTGTTATGCAGAAGAAGACACAG---GGCTGGGAACCC...AACACTGAGCGTCTCTTTGCA---...CGAGATGGAATGCTGATAGGAAACAACTTTATGGCTCTGAAG...TTGGAAGGAGGTGGTCACTATTTGTGTGAATTCAAATCTACTTACAAGGCAAAGAAGCCT---GTGAAGATG...---CCAGGGTATCACTATGTTGACCGCAAACTGGATGTAACCAATCACAACATA...GATTACACTTCCGTTGAGCAGTGTGAAATTTCCATTGCACGCAAACCT
TRN  10010101100011000
NAM  Q8T5F3_9CNID/6-223
ASQ  MK-VKEHMKIKLRMGGTVNGKHFAVNGTGDGYPYQGKQ..ILKLIVEGSEPLPFAFDILSAAFQYGNRAFTEYPTEI..ADYFKQSF-EFGeGFSWERSFTFEDGAICVATNDITM...VGG.....EFQYDIRFDGLNFPXDGPVMQKKTV-KWEP.STEIMYM-.QNGVLKGEVNMALL.LXDKSHYRCDLKTTYKAKNNVPHP.-PGYHYVDHCIEILEERK.DH--VKLREHAKARSS
NAM  Q8T5F0_9CNID/7-229
ASQ  KNVVKDFMKITLRMDGAVNGKPFAVNGTGDGNPYGGIQ..SLKLTVDGNKPLPFAFDILSAAFQYGNRAFTEYPKEI..SDYFKQSF-EFGeGFTWERSFTFEDGAICVATNDIKM...VGD.....EFQYNIRFDGVNFPEDGPVMQKKTV-KWEP.STEIMRV-.QGGVLKGEVNMALL.LKDKSHYRCDFKTTYKAKNPVPPTaLPXYHYVDHCIEITEENR.DYVKLQEYAKARSGLH
NAM  GLCP_CLASP/43-260
ASQ  MGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTH..TLNLEVKEGAPLPFSYDILSNAFQYGNRALTKYPDDI..ADYFKQSFPE--.GYSWERTMTFEDKGIVKVKSDISM...EED.....SFIYEIRFDGMNFPPNGPVMQKKTL-KWEP.STEIMYV-.RDGVLVGDISHSLL.LEGGGHYRCDFKSIYKAKKV-VKL.-PDYHFVDHRIEILNHDK.DYNKVTLYENAVARYS
DSQ  ATGGGTGTGATTAAACCAGACATGAAGATTAAGCTGAAGATGGAAGGAAATGTAAACGGGCATGCTTTTGTGATCGAAGGAGAAGGAGAAGGAAAGCCTTACGATGGGACACAC......ACTTTAAACCTGGAAGTGAAGGAAGGTGCGCCTCTGCCTTTTTCTTACGATATCTTGTCAAACGCGTTCCAGTACGGAAACAGAGCATTGACAAAATACCCAGACGATATA......GCAGACTATTTCAAGCAGTCGTTTCCCGAG------...GGATATTCCTGGGAAAGAACCATGACTTTTGAAGACAAAGGCATTGTCAAAGTGAAAAGTGACATAAGCATG.........GAGGAAGAC...............TCCTTTATCTATGAAATTCGTTTTGATGGGATGAACTTTCCTCCCAATGGTCCGGTTATGCAGAAAAAAACTTTG---AAGTGGGAACCA...TCCACTGAGATTATGTACGTG---...CGTGATGGAGTGCTGGTCGGAGATATTAGCCATTCTCTGTTG...CTGGAGGGAGGTGGCCATTACCGATGTGACTTCAAAAGTATTTACAAAGCAAAAAAAGTT---GTCAAATTG...---CCAGACTATCACTTTGTGGACCATCGCATTGAGATCTTGAACCATGACAAG...GATTACAACAAAGTAACGCTGTATGAGAATGCAGTTGCTCGCTATTCT
TRN  10010101100011000
NAM  Q8T6U0_9CNID/3-219
ASQ  -NLIKEDMRVKVHMEGNVNGHAFVIEGEGKGRPYEGTQ..TLNLTVKEGAPLPFSYDILTTALHYGNRVFTEYPADI..TDYFKQSFPE--.GYSWERTMTYEDKGICTIRSDISL...EGD.....CFFQNIRFNGMNFPPNGPVMQKKTL-KWEP.STEKLHV-.RDGLLVGNINMALL.LEGGGHYLCDFKTTYKAKKV-VQL.-PDYHFVDHRIEILSNDS.DYNKVKLYEHGVARYS
DSQ  ---AATCTGATTAAAGAAGATATGAGGGTTAAGGTGCATATGGAAGGGAATGTAAACGGGCATGCTTTTGTGATTGAAGGGGAAGGAAAAGGAAGGCCCTACGAAGGGACACAG......ACCTTGAACCTGACAGTGAAAGAAGGCGCGCCTCTCCCATTTTCTTACGACATCTTGACAACAGCATTGCACTACGGAAACAGAGTATTCACTGAATACCCAGCAGATATC......ACGGATTATTTCAAGCAATCATTTCCTGAA------...GGATATTCCTGGGAAAGAACCATGACTTATGAAGACAAGGGCATTTGTACCATCAGAAGCGACATAAGCTTG.........GAAGGTGAC...............TGCTTTTTCCAAAACATTCGTTTTAATGGGATGAACTTTCCCCCAAATGGTCCAGTTATGCAGAAGAAAACTTTG---AAGTGGGAACCA...TCCACAGAGAAGCTGCACGTG---...CGTGATGGGTTGCTTGTCGGTAATATTAACATGGCTCTGCTG...CTTGAAGGAGGTGGACATTACCTGTGTGACTTCAAAACTACTTACAAAGCGAAGAAGGTT---GTTCAGTTG...---CCAGATTATCATTTTGTGGACCATCGCATTGAGATCTTGAGTAATGACAGC...GATTACAACAAAGTGAAGCTGTACGAGCATGGGGTTGCTCGCTATTCT
TRN  10010101100011001
NAM  Q8T5F1_9CNID/1-219
ASQ  MSVIKSVMKIKLRMEGSVNGHNFVIVGEGEGKPYEGTQ..SMDLTVKEGAPLPFAYDIMTTVFHYGNRVFAKYPKHI..PDYFKQMFPE--.EYSWERSMNFEGGGICTARNEITM...EGD.....CFFNKVRFDGVNFPPNGPVMQKKTL-KWEP.STEKMYV-.RDGVLTGDINMALL.LEGGGHYRCDFRTTYRAKKKGVKL.-PDYHFEDHSIEILRHDK.EYTEVKLYEHAEAHSG
DSQ  ATGAGTGTGATTAAATCAGTCATGAAGATCAAGCTGCGTATGGAAGGCAGTGTAAACGGGCACAACTTCGTAATTGTTGGAGAAGGAGAAGGCAAGCCTTATGAGGGAACACAG......AGTATGGACCTTACAGTCAAAGAAGGCGCACCTCTGCCTTTCGCCTACGATATCATGACAACAGTATTCCATTACGGCAATAGGGTATTCGCAAAATACCCAAAACATATC......CCAGACTATTTCAAGCAGATGTTTCCTGAG------...GAGTATTCCTGGGAACGAAGCATGAATTTCGAAGGCGGGGGCATTTGCACCGCCAGGAACGAGATAACAATG.........GAAGGCGAC...............TGTTTTTTCAATAAAGTTCGATTTGATGGTGTGAACTTCCCCCCCAATGGTCCAGTCATGCAGAAGAAGACGCTG---AAATGGGAGCCA...TCCACTGAAAAAATGTATGTG---...CGTGATGGAGTGCTGACGGGTGATATCAACATGGCTTTGTTG...CTTGAAGGAGGTGGCCATTACCGATGTGACTTCAGAACTACTTACAGAGCTAAGAAGAAGGGTGTCAAGTTA...---CCAGATTATCACTTTGAGGATCACTCCATTGAGATTTTGCGCCATGACAAA...GAATACACTGAGGTTAAGCTGTATGAGCATGCCGAAGCTCATTCTGGG
TRN  10010101100011000
NAM  Q8I6J8_9CNID/1-219
ASQ  MSLIKPEMKIKLLMEGNVNGHQFVIEGDGKGHPFEGKQ..SMDLVVKEGAPLPFAYDILTTAFHYGNRVFAKYPDHI..PDYFKQSFPK--.GFSWERSLMFEDGGVCIATNDITL...KGD.....TFFNKVRFDGVNFPPNGPVMQKKTL-KWEA.STEKMYL-.RDGVLTGDITMALL.LKGDVHYRCDFRTTYKSRQEGVKL.-PGYHFVDHCISILRHDK.DYNEVKLYEHAVAHSG
DSQ  ATGAGTCTGATTAAACCAGAAATGAAGATCAAGCTGCTTATGGAAGGCAATGTAAACGGGCACCAGTTTGTTATTGAGGGAGATGGAAAAGGCCATCCTTTTGAGGGAAAACAG......AGTATGGACCTTGTAGTCAAAGAAGGCGCACCTCTCCCTTTTGCCTACGATATCTTGACAACAGCATTCCATTATGGTAACAGGGTTTTTGCTAAATACCCAGACCATATA......CCAGACTACTTCAAGCAGTCGTTTCCCAAA------...GGGTTTTCTTGGGAGCGAAGCCTGATGTTCGAGGACGGGGGCGTTTGCATCGCTACAAATGACATAACACTG.........AAAGGAGAC...............ACTTTTTTTAACAAAGTTCGATTTGATGGCGTAAACTTTCCCCCAAATGGTCCTGTTATGCAGAAGAAGACTCTG---AAATGGGAGGCA...TCCACTGAGAAAATGTATTTG---...CGTGATGGAGTGTTGACGGGCGATATTACCATGGCTCTGCTG...CTTAAAGGAGATGTCCATTACCGATGTGACTTCAGAACTACTTACAAATCTAGGCAGGAGGGTGTCAAGTTG...---CCAGGATATCACTTTGTCGATCACTGCATCAGCATATTGAGGCATGACAAA...GACTACAACGAGGTTAAGCTGTATGAGCATGCTGTTGCCCATTCTGGA
TRN  10010101100011011
NAM  Q8MU48_9CNID/1-218
ASQ  MSMIKPEMKIKMRMDGAVNGHKFVITGEGSGEPFEGKQ..TMNLTVIDGGPLPFAFDILTTAFDYGXRVFAKYPEDI..PDYFKQSFPE--.GFSWERSMTYEDGGICIATNDIKM...EGD.....CFSYEIRFDGVNFPANSPVMQKKTV-KWEP.CTXEMYV-.RDGVLKGGLNMALL.LEGGGHFRCDLKTTYKAKKV-VQM.-PDYHFVNHRLEITWHDE.DYNNVKLSEHAEAHSG
NAM  Q95VT0_9CNID/1-221
ASQ  MSVIKPDMKIKLRMEGAVNGHKFVIEGDGKGKPFEGTQ..SMDLTVIEGAPLPFAYDILTTVFDYGNRVFAKYPQDI..TDYFKQTFPE--.GYFWERSMTYEDQGICIATNDITMmkgVDD.....CFVYKIRFDGVNFPANGPVMQRKTL-KWEP.STEIMYA-.RDGVLKGDVNMALL.LEGGGHYRCDFKTTYKAKKV-VRL.-PDYHFVDHRIEIVSHDK.DYNKVKLYEHAEAXXG
DSQ  ATGAGTGTGATAAAACCAGACATGAAGATCAAGCTGCGTATGGAAGGCGCTGTAAACGGGCACAAGTTCGTGATTGAAGGAGACGGAAAGGGCAAGCCTTTCGAGGGAACACAG......AGTATGGACCTTACAGTCATAGAAGGCGCACCACTGCCTTTCGCTTACGATATCTTGACAACAGTATTCGATTACGGCAACAGGGTATTCGCCAAATACCCACAAGACATA......ACAGATTATTTCAAGCAGACGTTTCCTGAG------...GGGTACTTCTGGGAACGAAGCATGACATACGAAGACCAGGGCATTTGCATCGCCACAAACGACATAACAATGatgaaaggcGTCGACGAC...............TGTTTTGTCTATAAAATTCGATTTGATGGTGTGAACTTTCCTGCCAATGGTCCAGTTATGCAGAGGAAGACGCTG---AAATGGGAGCCA...TCCACTGAGATAATGTATGCG---...CGTGATGGAGTGCTGAAGGGTGATGTTAACATGGCTCTGTTG...CTTGAAGGAGGTGGCCATTACCGATGTGACTTCAAAACTACTTACAAAGCTAAGAAGGTT---GTCCGGTTG...---CCAGACTATCACTTTGTGGACCATCGCATTGAGATTGTGAGCCACGACAAA...GATTACAACAAGGTTAAGCTGTATGAGCATGCCGAAGCT------ACT
TRN  10010101100011011
NAM  Q963F5_9CNID/1-218
ASQ  MSVIKPIMEIKLRMQGVVNGHKFVIKGEGEGKPFEGTQ..TINLTVKEGAPLPFAYDILTSAFQYGNRVFTKYPDDI..PDYFKQTFPE--.GYSWERIMAYEDQSICTATSDIKM...EGD.....CFIYEIQFHGVNFPPNGPVMQKKTL-KWEP.STEKMYV-.RDGVLKGDVNMALL.LEGGGHYRCDFRSTYKAKKR-VQL.-PDYHFVDHRIEILSHDN.DYNTVKLSEDAEARYS
DSQ  ATGAGTGTGATTAAACCAATCATGGAGATCAAGCTGCGTATGCAAGGCGTTGTAAACGGGCACAAGTTCGTGATTAAAGGAGAAGGAGAGGGCAAGCCTTTCGAGGGAACGCAG......ACTATAAACCTTACAGTCAAAGAAGGCGCACCTCTCCCTTTTGCTTACGACATCTTGACATCAGCATTCCAGTATGGTAACAGGGTATTCACCAAATATCCAGACGATATA......CCAGACTATTTCAAGCAGACGTTTCCTGAA------...GGGTATTCGTGGGAGCGAATCATGGCTTATGAAGACCAGAGTATTTGCACGGCCACAAGCGACATAAAAATG.........GAAGGCGAC...............TGTTTTATCTACGAAATTCAATTTCATGGTGTGAACTTTCCACCCAATGGTCCAGTTATGCAGAAGAAGACGCTG---AAATGGGAGCCA...TCCACTGAGAAAATGTATGTG---...CGTGATGGAGTGCTGAAGGGTGATGTTAACATGGCTCTGTTG...CTTGAAGGAGGTGGCCATTACCGATGTGACTTTCGAAGTACTTACAAAGCGAAGAAACGT---GTTCAGTTG...---CCAGACTATCACTTTGTGGACCACCGCATTGAGATTTTGAGCCATGACAAT...GACTACAACACCGTAAAGCTGTCTGAGGATGCCGAGGCTCGCTATTCT
TRN  10010101100011001
NAM  Q95UA7_9CNID/1-218
ASQ  MSVIKSVMKIKLRMDGIVNGHKFMITGEGEGKPFEGTH..TIILKVKEGGPLPFAYDILTTAFQYGNRVFTKYPKDI..PDYFKQSFPE--.GYSWERSMTFEDQGVCTVTSDIKL...EGD.....CFFYEIRFYGVNFPSSGPVMQKKTL-KWEP.STENMYV-.RDGVLLGDVSRTLL.LEGDKHHRCNFRSTYGAKKG-VVL.-PEYHFVDHRIEILSHDK.DYNTVEVYENAVARPS
DSQ  ATGAGTGTGATTAAATCAGTCATGAAAATCAAGCTGCGTATGGACGGCATTGTAAACGGGCACAAGTTCATGATTACAGGAGAAGGTGAAGGCAAGCCTTTCGAGGGAACACAC......ACTATAATACTTAAAGTCAAAGAAGGCGGACCTCTGCCTTTCGCTTACGACATCTTGACAACAGCATTTCAGTACGGCAACAGGGTATTCACCAAATACCCAAAAGACATA......CCAGACTATTTCAAGCAGTCGTTTCCTGAG------...GGGTATTCCTGGGAAAGAAGCATGACTTTCGAAGACCAGGGCGTTTGCACCGTCACAAGCGACATAAAGTTG.........GAAGGCGAC...............TGTTTTTTCTACGAAATTCGATTTTATGGTGTGAACTTTCCCTCCAGTGGTCCAGTTATGCAGAAGAAGACGCTG---AAATGGGAGCCA...TCCACTGAGAATATGTACGTG---...CGTGATGGAGTGCTACTGGGGGATGTTAGCAGGACGCTGTTG...CTTGAAGGGGATAAACATCACCGATGTAACTTCAGAAGTACTTACGGGGCAAAGAAGGGT---GTCGTGTTG...---CCAGAATATCACTTTGTGGACCACCGAATTGAAATTCTGAGCCATGACAAA...GATTACAACACCGTTGAGGTGTATGAGAATGCCGTTGCTCGCCCTTCT
TRN  10010101100011001
NAM  Q8MU46_RICFL/1-221
ASQ  MNALQEEMKIKLTMVGVVNGQSFKIDGKGKGKPYEGSQ..ELTLKVVEGGPLLFSYDILTTIFQYGNRAFVNYPKDI..PDIFKQTCSGLDgGYSWQRTMTYEDGGVCTATSNVSV...VGD.....TFNYEIHFMGANFPPNGPVMQKRTV-KWEP.SXEIXFE-.RDGLLRGDVPMSLL.LKGGDHYRCDFKTIYKPNKK-VKL.-PGYHFVDHCIEIKSQEN.DYNMVALFEDAVAHYS
NAM  Q8MMA2_9CNID/34-254
ASQ  TNGIAEEMKTRVHLEGTVNGHSFTIKGEGRGYPYKGEQ..FMSLEVVNGAPLPFSFDILTPAFMYGNRVFTKYPPNI..PDYFKQTFPE--.GYHWERNIPFEDQAACTVTSHIRL...EEEe...rRFVNNVRFHCVNFPPNGPVMQRRIL-KWEP.STENIYP-.RDGFLEGHVDMTLR.VEGGGYYRAEFKSTYKGKTPVRDM.-PDFHFIDHRIEITEHDE.DYTNVELHDVSWARYS
DSQ  ACTAATGGGATTGCAGAGGAAATGAAGACTAGGGTACATTTGGAGGGTACTGTTAACGGGCACTCCTTTACAATTAAAGGCGAAGGAAGAGGCTACCCTTACAAAGGAGAACAG......TTTATGAGCCTTGAGGTCGTCAATGGTGCTCCTCTGCCGTTCTCTTTTGATATCTTGACACCAGCATTTATGTATGGCAACAGAGTGTTCACCAAGTACCCACCAAACATA......CCAGACTATTTCAAGCAGACGTTTCCTGAA------...GGGTATCACTGGGAAAGAAACATTCCCTTTGAAGATCAGGCCGCGTGCACGGTAACCAGCCACATAAGATTG.........GAAGAGGAAgag.........aggCGTTTTGTAAATAACGTCAGATTTCACTGTGTGAACTTTCCCCCTAATGGTCCAGTCATGCAGAGGAGGATACTG---AAATGGGAGCCA...TCCACTGAGAACATTTATCCG---...CGTGATGGGTTTCTGGAGGGCCATGTTGATATGACTCTTCGG...GTTGAAGGAGGTGGCTATTACCGAGCTGAGTTCAAAAGTACTTACAAAGGGAAGACCCCAGTCCGCGACATG...---CCAGACTTTCACTTCATAGACCACCGCATTGAGATTACGGAGCATGACGAA...GACTACACCAATGTTGAGCTGCATGACGTATCCTGGGCTCGTTACTCT
TRN  10010101100011011
NAM  Q8MMA1_9CNID/12-234
ASQ  VNGIAEEMKTDLIMEGIVNGHSFTIEGKGTGYXYKGDQ..FMKLEVVKGAPLPFSFDILTTAFMYGNRVFTKYPSNI..PDFFKQTFPE--.GYHWERIMPFEDQAVCTVTSHIRL...EEKeegemRFVDNVKFHCVNFPPNGPVMQRKIM-RWEP.STENMYP-.RNGLLEGYDEKTFR.LKGGGYYQAEHKSIYEGKGS-ISM.-PDFHFIDHRIMITNHDE.DYTNVELREVALARYS
NAM  GLCP_ANEMA/5-224
ASQ  NKFIGDDMKMTYHMDGCVNGHYFTVKGEGNGKPYEGTQtsTFKVTMANGGPLAFSFDILSTVFKYGNRCFTAYPTSM..PDYFKQAFPD--.GMSYERTFTYEDGGVATASWEISL...KGN.....CFEHKSTFHGVNFPADGPVMAKKTT-GWDP.SFEKMTV-.CDGILKGDVTAFLM.LQGGGNYRCQFHTSYKTKKP-VTM.-PPNHVVEHRIARTDLDK.GGNSVQLTEHAVAHIT
DSQ  AACAAGTTTATCGGAGATGACATGAAAATGACCTACCATATGGATGGCTGTGTCAATGGGCATTACTTTACCGTCAAAGGTGAAGGCAACGGGAAGCCATACGAAGGGACGCAGacttcgACTTTTAAAGTCACCATGGCCAACGGTGGGCCCCTTGCATTCTCCTTTGACATACTATCTACAGTGTTCAAATATGGAAATCGATGCTTTACTGCGTATCCTACCAGTATG......CCCGACTATTTCAAACAAGCATTTCCTGAC------...GGAATGTCATATGAAAGGACTTTTACCTATGAAGATGGAGGAGTTGCTACAGCCAGTTGGGAAATAAGCCTT.........AAAGGCAAC...............TGCTTTGAGCACAAATCCACGTTTCATGGAGTGAACTTTCCTGCTGATGGACCTGTGATGGCGAAGAAGACAACT---GGTTGGGACCCA...TCTTTTGAGAAAATGACTGTC---...TGCGATGGAATATTGAAGGGTGATGTCACCGCGTTCCTCATG...CTGCAAGGAGGTGGCAATTACAGATGCCAATTCCACACTTCTTACAAGACAAAAAAACCG---GTGACGATG...---CCACCAAACCATGTGGTGGAACATCGCATTGCGAGGACCGACCTTGACAAA...GGTGGCAACAGTGTTCAGCTGACGGAGCACGCTGTTGCACATATAACC
TRN  10010101100011001
NAM  Q8T4U4_9CNID/5-228
ASQ  KHGLTDDMTMHFRMEGCVDGHKFVIEGNGNGNPFKGKQ..FINLCVIEGGPLPFSEDILSAAFDYGNRLFTEYPEGI..VDYFKNSCPA--.GYTWHRSFRFEDGAVCICSADITVn.vREN.....CIYHESTFYGVNFPADGPVMKKMTT-NWEP.SCEKIIPInSQKILKGDVSMYLL.LKDGGRYRCQFDTIYKAKTEPKEM.-PDWHFIQHKLNREDRSDaKNQKWQLIEHAIASRS
DSQ  AAGCACGGACTAACAGATGACATGACAATGCATTTCCGTATGGAAGGGTGCGTCGATGGACATAAGTTTGTAATCGAGGGCAACGGCAATGGAAATCCTTTCAAAGGGAAACAG......TTTATTAATCTGTGTGTGATTGAAGGAGGACCACTGCCATTCTCCGAAGACATATTGTCTGCTGCGTTTGACTACGGAAACAGGCTCTTCACTGAATATCCTGAAGGCATA......GTTGACTATTTCAAGAACTCGTGTCCTGCT------...GGATATACGTGGCACAGGTCTTTTCGCTTTGAAGATGGAGCAGTTTGCATATGCAGTGCAGATATAACAGTAaat...gttAGGGAAAAC...............TGCATTTATCATGAGTCCACGTTTTATGGAGTGAACTTTCCTGCTGATGGACCTGTGATGAAAAAGATGACAACT---AATTGGGAACCG...TCCTGCGAGAAAATCATACCAATAaatAGTCAGAAGATATTAAAAGGGGATGTCTCCATGTACCTCCTT...CTGAAGGATGGTGGGCGTTACCGCTGCCAGTTTGACACAATTTACAAAGCAAAGACTGAGCCAAAAGAAATG...---CCGGACTGGCACTTCATCCAGCATAAGCTCAACCGTGAAGACCGCAGCGATgctAAGAATCAGAAATGGCAACTGATAGAACATGCTATTGCATCCCGATCT
TRN  10010101100011010
NAM  Q9GPI6_ANESU/2-219
ASQ  YPSIKETMRVQLSMEGSVNYHAFKCTGKGEGKPYEGTQ..SLNITITEGGPLPFAFDILSHAFQYGIKVFAKYPKEI..PDFFKQSLPG--.GFSWERVSTYEDGGVLSATQETSL...QGD.....CIICKVKVLGTNFPANGPVMQKKTC-GWEP.STETVIP-.RDGGLLLRDTPALM.LADGGHLSCFMETTYKSKKE-VKL.-PELHFHHLRMEKLNISD.DWKTVEQHESVVASYS
DSQ  TATCCTTCCATCAAGGAAACCATGCGCGTTCAGCTTTCTATGGAGGGTAGTGTTAACTACCACGCCTTCAAGTGCACTGGAAAAGGAGAGGGAAAACCATACGAAGGCACCCAA......AGCCTGAATATTACAATAACTGAAGGAGGTCCTCTGCCATTTGCTTTTGACATTCTGTCACACGCCTTTCAGTATGGCATCAAGGTCTTCGCCAAGTACCCCAAAGAAATT......CCTGACTTCTTTAAGCAGTCTCTACCTGGT------...GGTTTTTCTTGGGAAAGAGTAAGCACCTATGAAGATGGAGGAGTGCTTTCAGCTACCCAAGAAACAAGTTTG.........CAGGGTGAT...............TGCATCATCTGCAAAGTTAAAGTCCTTGGCACCAATTTTCCCGCAAACGGTCCAGTGATGCAAAAGAAGACCTGT---GGATGGGAGCCA...TCAACTGAAACAGTCATCCCA---...CGAGATGGTGGACTTCTGCTTCGCGATACCCCCGCACTTATG...CTGGCTGACGGAGGTCATCTTTCTTGCTTCATGGAAACAACTTACAAGTCGAAGAAAGAG---GTAAAGCTT...---CCAGAACTTCACTTTCATCATTTGCGTATGGAAAAGCTGAACATAAGTGAC...GATTGGAAGACCGTTGAGCAGCACGAGTCTGTGGTGGCTAGCTACTCC
TRN  10010101100011001
NAM  Q8T5E7_CONGI/2-220
ASQ  YPWIKETMRSKVYMEGDVNNHAFKCTAVGEGKPYKGSQ..DLTITVTEGGPLPFAFDILSHAFQYGNKVFTDYPDDI..PDFFKQSLSD--.GFTWRRVSXYXXGGVLTVTQDTSL...KGD.....CIICNIKVHGTNFPENGPVMQNKTD-GWEPsSTETVIP-.QDGGIVAARSPALR.LRDKGHLICHMETTYKPNKE-VKL.-PELHFHHLRMEKLSVSD.DGKTIKQHEYVVASYS
NAM  Q8T6T9_RADMA/2-220
ASQ  CSYIKETMQSKVYMEGKVNDHNFKCTAEGKGEPYKGSQ..SLTITVTEGGPLPFAFDILSHAFRYGNKVFAKYPKDH..PDFFKQSLPE--.GFTWERVSNYEDGGVLTVKQETSL...EGD.....CIICKIKAHGTNFPADGPVMQKRTN-GWEP.STETVIP-.RGGGILMRDVPALKlLGNKGHLLCVMETTYKSKKK-VNL.-PKPHFHHLRMEKDSVSD.DEKTIEQHENVRASYF
DSQ  TGTTCTTACATCAAAGAAACCATGCAAAGTAAGGTTTACATGGAAGGAAAAGTTAACGACCACAACTTCAAGTGCACTGCAGAAGGAAAAGGAGAACCATACAAAGGCTCACAA......AGCCTGACGATCACCGTAACTGAAGGAGGTCCTCTGCCATTTGCCTTCGACATTCTTTCACACGCCTTTCGATATGGCAATAAGGTGTTCGCCAAGTACCCCAAAGATCAT......CCTGATTTTTTTAAGCAGTCTCTTCCTGAA------...GGTTTTACTTGGGAAAGAGTAAGCAACTATGAGGACGGAGGAGTCCTTACCGTTAAACAAGAAACTAGTCTG.........GAGGGAGAT...............TGCATTATTTGCAAAATTAAAGCACATGGCACTAACTTCCCCGCAGATGGTCCGGTGATGCAAAAACGGACCAAT---GGATGGGAGCCA...TCAACTGAAACGGTTATTCCA---...CGGGGTGGAGGAATTCTGATGCGCGATGTGCCCGCACTGAAGctgCTTGGTAACAAAGGACATCTTCTCTGCGTCATGGAAACAACTTACAAGTCAAAAAAAAAG---GTGAACCTG...---CCAAAACCGCACTTTCATCATTTGAGAATGGAGAAGGATAGTGTTAGTGAC...GATGAGAAGACCATTGAGCAGCACGAGAATGTGAGGGCAAGCTACTTC
TRN  10010101100011001
NAM  Q9GPI5_ANESU/2-222
ASQ  ASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQ..EMKIEVIEGGPLPFAFHILSTSCMYGSKTFIKYVSGI..PDYFKQSFPE--.GFTWERTTTYEDGGFLTAHQDTSL...DGD.....CLVYKVKILGNNFPADGPVMQNKAE-RWEP.ATEILYE-.VDGVLRGQSLMALK.CPGGRHLTCHLHSTYRSKKPASALkMPGFHFGDHRIEIMEEVE.KGKCYKQYEAAVARYC
DSQ  GCTTCCTTTTTAAAGAAGACTATGCCCTTTAAGACGACCATTGAAGGGACGGTTAATGGCCACTACTTCAAGTGTACAGGAAAAGGAGAGGGCAACCCATTTGAGGGTACGCAG......GAAATGAAGATAGAGGTCATCGAAGGAGGTCCATTGCCATTTGCCTTCCACATTTTGTCAACGAGTTGTATGTACGGTAGTAAGACCTTCATCAAGTACGTGTCAGGAATT......CCAGACTACTTCAAGCAGTCTTTCCCTGAA------...GGTTTTACTTGGGAAAGAACCACAACCTACGAGGATGGAGGCTTTCTTACAGCTCATCAGGACACAAGCCTA.........GATGGAGAT...............TGCCTCGTTTACAAGGTCAAGATTCTTGGTAATAATTTTCCTGCTGATGGCCCCGTGATGCAGAACAAAGCAGAA---AGATGGGAGCCA...GCCACCGAGATACTTTATGAA---...GTTGACGGTGTCCTGCGTGGACAGTCTTTGATGGCCCTTAAG...TGCCCTGGTGGTCGTCATCTGACTTGCCATCTCCATTCTACTTACAGGTCCAAAAAACCAGCTAGTGCCTTGaagATGCCAGGATTTCATTTTGGAGATCATCGCATCGAGATAATGGAGGAAGTTGAG...AAAGGCAAGTGCTATAAACAGTACGAAGCAGCAGTGGCCAGGTACTGT
TRN  10010101100011000
NAM  NFCP_CONPS/2-220
ASQ  AGLLKESMRIKIYMEGTVNGYHFKCEGEGDGNPYEGTQ..NMRIRVTEGAPLPFAFDILSPCCAYGSKTFIKHTSGI..PDYFKQSFPE--.GFTWERTTIYEDGGVLTAHQDTSL...EGN.....CLNYKVKVLGTNFPADGPVMKNISG-GWEP.CTEIVYQ-.DNGVLRGRNVMALK.VSGRPPLICHLHSTYRSKKA-CALtMPGFHFADLRIQMPKKK-.KDEYFELYEASVARYS
DSQ  GCTGGTTTGTTGAAAGAAAGTATGCGCATCAAGATCTACATGGAAGGGACAGTTAATGGCTATCATTTCAAGTGTGAAGGAGAAGGAGACGGCAATCCATATGAAGGTACGCAG......AACATGAGGATTCGTGTCACCGAAGGAGCTCCATTACCATTTGCCTTCGACATTTTGTCACCGTGTTGTGCCTACGGCAGCAAGACCTTCATCAAACATACTTCAGGGATT......CCCGACTACTTCAAGCAGTCTTTCCCTGAA------...GGCTTTACTTGGGAAAGAACCACAATCTATGAAGATGGAGGAGTTCTAACTGCTCATCAGGACACAAGCCTC.........GAGGGGAAC...............TGCCTTAATTACAAGGTGAAAGTACTTGGTACCAACTTTCCTGCTGACGGCCCCGTGATGAAGAACATATCAGGA---GGATGGGAACCA...TGCACTGAGATCGTTTATCAA---...GACAATGGTGTCCTGCGTGGACGTAATGTGATGGCCCTTAAA...GTCAGTGGTCGTCCTCCTTTGATCTGCCATCTCCATTCTACTTACAGGTCCAAGAAAGCC---TGTGCCTTGaccATGCCAGGATTTCATTTCGCAGACCTCCGCATTCAGATGCCGAAGAAAAAG---...AAAGACGAGTACTTTGAACTGTACGAAGCATCGGTGGCTAGGTACAGT
TRN  10010101100011000
NAM  DSRD_PARAC/2-222
ASQ  NSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQ..TMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGI..PDFFKQSFPE--.GFTWERVTRYEDGGVFTVMQDTSL...EDG.....CLVYHAKVTGVNFPSNGAVMQKKTK-GWEP.NTEMLYP-.ADGGLRGYSQMALN.VDGGGYLSCSFETTYRSKKTVENFkMPGFHFVDHRLERLEESD.KEMFVVQHEHAVAKFC
DSQ  AATTCACTGATCAAGGAAAATATGCGTATGATGGTGGTCATGGAAGGTTCGGTCAACGGCTACCAATTCAAATGCACAGGTGAAGGAGATGGCAATCCATACATGGGAACTCAA......ACCATGAGGATCAAAGTCGTCGAGGGAGGACCTCTGCCATTTGCCTTTGACATTCTTGCCACAAGCTTCATGTATGGCAGCAAGACTTTTATCAAGCACACTAAAGGCATT......CCTGATTTCTTTAAACAGTCCTTTCCTGAG------...GGTTTTACTTGGGAAAGAGTTACAAGATACGAAGATGGTGGAGTCTTTACCGTTATGCAGGACACCAGCCTT.........GAAGATGGC...............TGTCTCGTTTACCACGCCAAAGTCACTGGGGTAAACTTTCCCTCCAATGGTGCCGTGATGCAGAAGAAGACCAAG---GGTTGGGAGCCA...AATACAGAGATGCTGTATCCA---...GCAGATGGTGGTCTGAGGGGATACTCTCAAATGGCACTGAAT...GTTGATGGTGGTGGCTATCTGTCTTGCTCTTTCGAAACAACTTACAGGTCAAAAAAGACCGTCGAGAACTTCaagATGCCCGGTTTCCATTTTGTTGATCACCGCCTGGAAAGGTTAGAGGAAAGTGAC...AAGGAAATGTTCGTAGTACAACACGAACACGCAGTTGCCAAGTTCTGT
TRN  10010101100011000
NAM  Q9BLZ0_9CNID/8-225
ASQ  NTGLKEIMSAKASVEGIVNNHVFSMEGFGKGNVLFGNQ..LMQIRVTKGGPLPFAFDIVSIAFQYGNRTFTKYPDDI..ADYFVQSFPA--.GFFYERNLRFEDGAIVDIRSDISL...EDD.....KFHYKVEYRGNGFPSNGPVMQKAIL-GMEP.SFEVVYM-.NSGVLVGEVDLVYK.LESGNYYSCHMKTFYRSKGGVKEF.-PEYHFIHHRLEKTYVE-.EGSFVEQHETAIAQLT
DSQ  AACACTGGACTGAAAGAGATTATGTCGGCAAAAGCTAGCGTTGAAGGAATCGTGAACAATCACGTTTTTTCCATGGAAGGATTTGGAAAAGGCAATGTATTATTTGGAAACCAA......TTGATGCAAATCCGGGTTACAAAGGGAGGTCCGTTGCCATTCGCTTTCGATATTGTTTCCATAGCTTTCCAATACGGGAATCGCACTTTCACGAAATACCCAGACGACATT......GCGGACTACTTTGTTCAATCATTCCCGGCT------...GGATTTTTCTACGAAAGAAATCTACGCTTTGAAGATGGCGCCATTGTTGACATTCGTTCAGATATAAGTTTA.........GAAGATGAT...............AAGTTCCACTACAAAGTGGAGTATAGAGGCAACGGTTTCCCTAGTAACGGACCCGTGATGCAAAAAGCCATCCTC---GGCATGGAGCCA...TCGTTTGAGGTGGTCTACATG---...AACAGCGGCGTTCTGGTGGGCGAAGTAGATCTCGTTTACAAA...CTCGAGTCAGGGAACTATTACTCGTGCCACATGAAAACGTTTTACAGATCCAAAGGTGGAGTGAAAGAATTC...---CCGGAATATCACTTTATCCATCATCGTCTGGAGAAAACCTACGTGGAA---...GAAGGAAGCTTCGTGGAACAACACGAGACGGCCATTGCACAACTGACC
TRN  10010101100011000
NAM  Q9BLY9_9CNID/8-225
ASQ  NTCLQEVMSYKVNLEGIVNNHVFTMEGCGKGNILFGNQ..LVQIRVTKGAPLPFAFDIVSPAFQYGNRTFTKYPNDI..SDYFIQSFPA--.GFMYERTLRYEDGGLVEIRSDINL...IED.....KFVYRVEYKGSNFPDDGPVMQKTIL-GIEP.SFEAMYM-.NNGVLVGEVILVYK.LNSGKYYSCHMKTLMKSKGVVKEF.-PSYHFIQHRLEKTYVE-.DGGFVEQHETAIAQMT
DSQ  AACACTTGTTTACAAGAAGTAATGTCGTATAAAGTAAATCTGGAAGGAATTGTAAACAACCATGTTTTTACAATGGAGGGTTGCGGCAAAGGGAATATTTTATTCGGCAATCAA......CTGGTTCAGATTCGTGTCACGAAAGGGGCCCCACTGCCTTTTGCATTTGATATTGTGTCACCAGCTTTTCAATATGGCAACCGTACTTTCACGAAATATCCGAATGATATA......TCAGATTATTTTATACAATCATTTCCAGCA------...GGATTTATGTATGAACGAACATTACGTTACGAAGATGGCGGACTTGTTGAAATTCGTTCAGATATAAATTTA.........ATAGAAGAC...............AAGTTCGTCTACAGAGTGGAATACAAAGGTAGTAACTTCCCAGATGATGGTCCCGTCATGCAGAAGACTATCTTA---GGAATAGAGCCT...TCATTTGAAGCCATGTACATG---...AATAATGGCGTCTTGGTCGGCGAAGTAATTCTTGTCTATAAA...CTAAACTCTGGGAAATATTATTCATGTCACATGAAAACATTAATGAAGTCGAAAGGTGTAGTAAAGGAGTTT...---CCTTCGTATCATTTTATTCAACATCGTTTGGAAAAGACTTACGTAGAA---...GACGGGGGGTTCGTTGAACAGCATGAGACTGCTATTGCTCAAATGACA
TRN  10010101100011000
NAM  Q963I9_RENRE/5-223
ASQ  KLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQ..EVKISVTKGAPLPFAFDIVSVAFSYGNRAYTGYPEEI..SDYFLQSFPE--.GFTYERNIRYQDGGTAIVKSDISL...EDG.....KFIVNVDFKAKDLRRMGPVMQQDIV-GMQP.SYESMYT-.NVTSVIGECIIAFK.LQTGKHFTYHMRTVYKSKKPVETM.-PLYHFIQHRLVKTNVDT.ASGYVVQHETAIAAHS
DSQ  AAACTTGGTTTGAAGGAAGTGATGCCTACTAAAATCAACTTAGAAGGACTGGTTGGCGACCACGCTTTCTCAATGGAAGGAGTTGGCGAAGGCAACATATTGGAAGGAACTCAA......GAGGTGAAGATATCGGTAACAAAAGGCGCACCACTCCCATTCGCATTTGATATCGTATCTGTGGCTTTTTCATATGGGAACAGAGCTTATACCGGTTACCCAGAAGAAATT......TCCGACTACTTCCTCCAGTCGTTTCCAGAA------...GGCTTTACTTACGAGAGAAACATTCGTTATCAAGATGGAGGAACTGCAATTGTTAAATCTGATATAAGCTTG.........GAAGATGGT...............AAATTCATAGTGAATGTAGACTTCAAAGCGAAGGATCTACGTCGCATGGGACCAGTCATGCAGCAAGACATCGTG---GGTATGCAGCCA...TCGTATGAGTCAATGTACACC---...AATGTCACTTCAGTTATAGGGGAATGTATAATAGCATTCAAA...CTTCAAACTGGCAAGCATTTCACTTACCACATGAGGACAGTTTACAAATCAAAGAAGCCAGTGGAAACTATG...---CCATTGTATCATTTCATCCAGCATCGCCTCGTTAAGACCAATGTGGACACA...GCCAGTGGTTACGTTGTGCAACACGAGACAGCAATTGCAGCGCATTCT
TRN  10010101100011000
NAM  GFP_AEQVI/5-229
ASQ  EELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL..TLKF-ICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMkqHDFFKSAMPE--.GYVQERTIFFKDDGNYKTRAEVKF...EGD.....TLVNRIELKGIDFKEDGNILGHKLEYNYNS.HNVYIMADkQKNGIKVNFKIRHNiEDGSVQLADHYQQNTPIGDGPVLL.-PDNHYLSTQSALSKDPNeKRDHMVLLEFVTAAGI
DSQ  GAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTT......ACCCTTAAATTT---ATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCAAGATACCCAGATCATATGaaacagCATGACTTTTTCAAGAGTGCCATGCCCGAA------...GGTTATGTACAGGAAAGAACTATATTTTTCAAAGATGACGGGAACTACAAGACACGTGCTGAAGTCAAGTTT.........GAAGGTGAT...............ACCCTTGTTAATAGAATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAATTGGAATACAACTATAACTCA...CACAATGTATACATCATGGCAGACaaaCAAAAGAATGGAATCAAAGTTAACTTCAAAATTAGACACAACattGAAGATGGAAGCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTA...---CCAGACAACCATTACCTGTCCACACAATCTGCCCTTTCGAAAGATCCCAACgaaAAGAGAGACCACATGGTCCTTCTTGAGTTTGTAACAGCTGCTGGGATT
TRN  10010101100011000
//