EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01340 - MetJ)
FAM  PF01340
PID  MetJ
DES  Met Apo-repressor, MetJ
IPR  IPR002084
ANO  3
ALN  104
AID  0.911177
APH  (METJ_SALTY/1-104:0.00000,METJ_ECOLI/1-104:0.01937,METJ_HAEIN/2-105:0.18530);
ATP  (METJ_SALTY/1-104,METJ_ECOLI/1-104,METJ_HAEIN/2-105);
ATL  0.20467
DNO  3
DLN  312
DID  0.788462
DPH  (METJ_SALTY/1-104:0.02868,METJ_ECOLI/1-104:0.03129,METJ_HAEIN/2-105:0.35548);
DTP  (METJ_SALTY/1-104,METJ_ECOLI/1-104,METJ_HAEIN/2-105);
DTL  0.41545
RID  0.911177
RPH  (METJ_SALTY/1-104:0.00000,METJ_ECOLI/1-104:0.01937,METJ_HAEIN/2-105:0.18530);
RTP  (METJ_SALTY/1-104,METJ_ECOLI/1-104,METJ_HAEIN/2-105);
RTL  0.20467
LNK  METJ_ECOLI/1-104:P08338:M12869
LNK  METJ_HAEIN/2-105:P44618:U32715
LNK  METJ_SALTY/1-104:P06203:X01961
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  METJ_SALTY/1-104
ASQ  AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMRELGIDPETWEY
DSQ  GCTGAATGGAGCGGCGAATATATCAGCCCATACGCTGAGCACGGTAAGAAGAGTGAGCAAGTCAAAAAAATTACGGTTTCCATTCCTCTGAAGGTGTTAAAAATCCTCACCGATGAACGTACGCGTCGTCAGGTGAACAACCTGCGCCACGCCACCAACAGCGAGCTGTTGTGTGAAGCATTTCTGCACGCCTTTACCGGGCAACCCTTGCCGGATGATGCCGATCTGCGAAAAGAGCGCAGCGATGAAATCCCGGAAGCGGCAAAAGAGATCATGCGTGAGTTGGGGATTGATCCGGAAACGTGGGAATAC
TRN  11011101101011010
NAM  METJ_ECOLI/1-104
ASQ  AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
DSQ  GCTGAATGGAGCGGCGAATATATCAGCCCATACGCTGAGCACGGCAAGAAGAGTGAACAAGTCAAAAAGATTACGGTTTCCATTCCTCTTAAGGTGTTAAAAATCCTCACCGATGAACGCACGCGTCGTCAGGTGAACAACCTGCGTCACGCTACCAACAGCGAGCTGCTGTGCGAAGCGTTTCTGCATGCCTTTACCGGGCAACCTTTGCCGGATGATGCCGATCTGCGTAAAGAGCGCAGCGACGAAATCCCGGAAGCGGCAAAAGAGATCATGCGTGAGATGGGGATTAACCCGGAGACGTGGGAATAC
TRN  11011101101011010
NAM  METJ_HAEIN/2-105
ASQ  ANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQLKSLRHATNSELLCEAFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMRELGVDPESWEY
DSQ  GCGAATTGGGACGGAAAATATATCAGCCCTTATGCAGAACATGGCAAAAAAAGTGAGCAAGTAAAAAAAATTACAGTATCCATTCCCATTAAAGTACTGGAAATTTTGACGAATGAACGCACTCGCCGCCAATTAAAAAGTTTACGTCACGCAACTAACAGTGAATTGCTTTGTGAAGCGTTCTTGCATGCATTCACAGGACAACCTTTACCCACCGATGCAGATTTAATGAAAGAGCGTAATGATGAAATCCCTGAAGATGCCAAAGTGCTTATGCGTGAATTAGGTGTCGATCCAGAAAGCTGGGAATAT
TRN  11011101101011010
//