EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01325 - Fe_dep_repress)
FAM  PF01325
PID  Fe_dep_repress
DES  Iron dependent repressor, N-terminal DNA binding domain
IPR  IPR001367
ANO  10
ALN  62
AID  0.313386
APH  (((((((O30276_ARCFU/1-61:0.35321,MNTR_BACSU/1-61:0.71241):0.05746,P72424_STAEP/1-61:0.77899):0.16318,O28489_ARCFU/1-60:0.39257):0.16499,(O26316_METTH/6-66:0.45105,O27019_METTH/11-70:0.31948):0.14691):0.42402,O33330_MYCTU/9-70:0.85214):0.28538,O28295_ARCFU/7-68:0.88820):1.04367,DTXR_CORDI/3-63:0.02403,Q50379_MYCSM/3-63:0.14084);
ATP  (((((((O30276_ARCFU/1-61,MNTR_BACSU/1-61),P72424_STAEP/1-61),O28489_ARCFU/1-60),(O26316_METTH/6-66,O27019_METTH/11-70)),O33330_MYCTU/9-70),O28295_ARCFU/7-68),DTXR_CORDI/3-63,Q50379_MYCSM/3-63);
ATL  7.14252
DNO  10
DLN  186
DID  0.418524
DPH  ((((((O30276_ARCFU/1-61:0.38122,(P72424_STAEP/1-61:0.62614,MNTR_BACSU/1-61:0.39162):0.07476):0.22042,O26316_METTH/6-66:0.32356):0.09594,O27019_METTH/11-70:0.30824):0.15516,O28489_ARCFU/1-60:0.23759):0.27898,(O28295_ARCFU/7-68:0.60238,O33330_MYCTU/9-70:0.50124):0.05598):0.69266,DTXR_CORDI/3-63:0.25007,Q50379_MYCSM/3-63:0.14658);
DTP  ((((((O30276_ARCFU/1-61,(P72424_STAEP/1-61,MNTR_BACSU/1-61)),O26316_METTH/6-66),O27019_METTH/11-70),O28489_ARCFU/1-60),(O28295_ARCFU/7-68,O33330_MYCTU/9-70)),DTXR_CORDI/3-63,Q50379_MYCSM/3-63);
DTL  5.36473
RID  0.313386
RPH  (((((((O30276_ARCFU/1-61:0.35321,MNTR_BACSU/1-61:0.71241):0.05746,P72424_STAEP/1-61:0.77899):0.16318,O28489_ARCFU/1-60:0.39257):0.16499,(O26316_METTH/6-66:0.45105,O27019_METTH/11-70:0.31948):0.14691):0.42402,O33330_MYCTU/9-70:0.85214):0.28538,O28295_ARCFU/7-68:0.88820):1.04367,DTXR_CORDI/3-63:0.02403,Q50379_MYCSM/3-63:0.14084);
RTP  (((((((O30276_ARCFU/1-61,MNTR_BACSU/1-61),P72424_STAEP/1-61),O28489_ARCFU/1-60),(O26316_METTH/6-66,O27019_METTH/11-70)),O33330_MYCTU/9-70),O28295_ARCFU/7-68),DTXR_CORDI/3-63,Q50379_MYCSM/3-63);
RTL  7.14252
LNK  DTXR_CORDI/3-63:P33120:M80336
LNK  MNTR_BACSU/1-61:P54512:D84432
LNK  O26316_METTH/6-66:O26316:AE000808
LNK  O27019_METTH/11-70:O27019:AE000868
LNK  O28295_ARCFU/7-68:O28295:AE000966
LNK  O28489_ARCFU/1-60:O28489:AE000979
LNK  O30276_ARCFU/1-61:O30276:AE001111
LNK  O33330_MYCTU/9-70:O33330:BX842580
LNK  P72424_STAEP/1-61:P72424:X99128
LNK  Q50379_MYCSM/3-63:Q50379:U14190
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  MNTR_BACSU/1-61
ASQ  MTTPSMEDYIEQIYMLIE-EKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLV
DSQ  ATGACAACACCAAGTATGGAAGATTATATTGAACAGATTTATATGCTGATTGAA---GAAAAAGGATATGCACGAGTTTCCGATATCGCGGAAGCATTGGCAGTCCATCCCTCCTCTGTAACAAAAATGGTTCAAAAACTAGATAAAGACGAATATTTAATTTATGAAAAATATCGCGGTCTCGTG
TRN  11011101101011010
NAM  O30276_ARCFU/1-61
ASQ  MLGSRAEDYLEAIYSLSK-EKGYAKVMELSEVLNVKPATVSEMLEKLSRMGYVEYKKRSHVK
DSQ  ATGTTGGGGAGCAGGGCTGAGGACTATCTCGAAGCTATCTACAGTCTGAGCAAA---GAGAAGGGTTATGCAAAGGTGATGGAGCTCTCCGAAGTGCTGAATGTCAAGCCCGCAACCGTTTCCGAGATGCTCGAAAAGCTCTCCAGAATGGGATATGTGGAATACAAAAAAAGGTCTCACGTAAAG
TRN  10010101100011011
NAM  O28489_ARCFU/1-60
ASQ  --MERIEEYLEAIYDIQEETSKVAKTGELAKILNVKPSSVTEMLIKLRDMGYVDYQPYKGAK
DSQ  ------ATGGAGAGGATAGAAGAGTACCTTGAGGCGATTTACGACATTCAGGAGGAGACGAGCAAGGTTGCAAAAACAGGTGAACTTGCAAAAATCCTCAACGTAAAACCATCCAGCGTTACGGAGATGCTAATAAAACTCAGAGATATGGGATACGTGGACTATCAGCCGTACAAAGGAGCAAAG
TRN  10010101110011011
NAM  O27019_METTH/11-70
ASQ  ELTRSMENYLETLYRLS--SHGIVKTSDLSSRMNVRPASVTQMLKRLHEMGLVIYHPYLGAE
DSQ  GAACTCACAAGGAGCATGGAAAACTACCTCGAGACATTATACAGGTTAAGT------AGTCACGGGATCGTTAAAACCTCTGACCTGTCATCAAGGATGAACGTCAGACCAGCCAGTGTAACCCAGATGCTCAAGAGACTCCATGAAATGGGCCTTGTCATCTACCACCCATACCTGGGGGCTGAA
TRN  10010101100011000
NAM  O26316_METTH/6-66
ASQ  HLSENIEEYLETIYRLSD-SRKPVTTTDISREMKIAPASVTQMLKKLDSNGYVKYSPYRGAV
DSQ  CATCTCAGTGAAAATATAGAGGAATACCTTGAAACCATCTACAGGCTCTCGGAT---TCAAGGAAGCCCGTTACCACCACAGACATCTCCCGGGAAATGAAAATCGCCCCTGCAAGTGTAACCCAGATGCTTAAAAAGCTTGATTCAAATGGATATGTTAAATATTCACCATACAGGGGAGCCGTG
TRN  10010101110011001
NAM  P72424_STAEP/1-61
ASQ  MLTEEKEDYLKAILTNDG-DVSFVSNKKLSQFLNIKPPSVSEMVGRLEKEGYVETKHYKGAR
DSQ  ATGTTAACTGAAGAAAAAGAGGATTATTTGAAAGCAATTTTGACTAATGATGGC---GACGTGTCCTTTGTATCAAATAAAAAACTATCGCAATTTTTAAATATCAAACCACCATCAGTAAGTGAAATGGTAGGGCGTTTAGAAAAGGAAGGCTATGTTGAAACAAAACATTATAAAGGTGCCCGT
TRN  11011101111011000
NAM  O33330_MYCTU/9-70
ASQ  DLSAVAQDYLKVIWTAQEWSQDKVSTKMLAERIGVSASTASESIRKLAEQGLVDHEKYGAVT
DSQ  GATCTTAGCGCGGTTGCGCAGGACTATCTGAAGGTCATCTGGACCGCCCAGGAGTGGTCGCAGGACAAGGTCAGCACCAAGATGCTGGCCGAGAGGATCGGGGTGTCGGCCAGCACGGCCTCGGAGTCCATTCGCAAGCTCGCCGAGCAGGGCTTGGTCGACCACGAGAAGTACGGCGCGGTGACG
TRN  10010101100011011
NAM  Q50379_MYCSM/3-63
ASQ  DLVDTTEMYLRTIYDLEE-EGVVPLRARIAERLDQSGPTVSQTVSRMERDGLLHVAGDRHLE
DSQ  GATCTTGTCGATACCACCGAGATGTACCTGCGGACGATTTACGACCTCGAGGAA---GAGGGCGTCGTGCCGCTGCGGGCGCGCATCGCCGAGCGACTCGACCAGAGTGGCCCCACCGTGAGCCAGACGGTCTCGCGCATGGAGCGCGACGGTCTGTTGCACGTCGCGGGTGACCGGCACCTCGAA
TRN  11011111101111111
NAM  DTXR_CORDI/3-63
ASQ  DLVDTTEMYLRTIYELEE-EGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQ
DSQ  GACTTAGTCGATACCACAGAGATGTACTTGCGCACTATCTATGAGCTGGAAGAA---GAGGGAGTCACTCCCCTTCGCGCTAGGATCGCCGAGCGTCTGGAACAATCTGGACCTACAGTTAGCCAAACCGTTGCCCGTATGGAGCGCGATGGACTTGTCGTTGTCGCCTCAGACCGTAGTCTACAA
TRN  10010101100011000
NAM  O28295_ARCFU/7-68
ASQ  KFVTKTEVVLRTVYTALEKGLAVIGPTQVAEELGVSKSTAQKMLNELSKAGYGVYVPKKGLV
DSQ  AAGTTTGTTACAAAAACAGAGGTTGTGCTCAGAACAGTTTACACCGCACTTGAGAAAGGTCTTGCAGTAATCGGTCCCACGCAGGTTGCGGAGGAGCTTGGCGTGTCGAAATCAACAGCTCAGAAAATGCTGAACGAACTGTCTAAGGCAGGCTACGGCGTTTACGTCCCGAAGAAGGGATTGGTT
TRN  10010101100011001
//