EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01294 - Ribosomal_L13e)
FAM  PF01294
PID  Ribosomal_L13e
DES  Ribosomal protein L13e
IPR  IPR001380
ANO  6
ALN  180
AID  0.537659
APH  ((((RL13_SCHMA/6-184:0.37663,RL13B_YEAST/7-173:0.51984):0.07761,RL13_CHICK/6-184:0.23725):0.09152,RL13_DROME/6-185:0.26886):0.34202,RL131_BRANA/5-183:0.10899,RL13_TOBAC/1-179:0.28465);
ATP  ((((RL13_SCHMA/6-184,RL13B_YEAST/7-173),RL13_CHICK/6-184),RL13_DROME/6-185),RL131_BRANA/5-183,RL13_TOBAC/1-179);
ATL  2.31356
DNO  6
DLN  540
DID  0.535181
DPH  (RL13_SCHMA/6-184:0.38214,((RL13_CHICK/6-184:0.25079,RL13_DROME/6-185:0.27788):0.15846,(RL131_BRANA/5-183:0.18304,RL13_TOBAC/1-179:0.20793):0.20359):0.07136,RL13B_YEAST/7-173:0.48271);
DTP  (RL13_SCHMA/6-184,((RL13_CHICK/6-184,RL13_DROME/6-185),(RL131_BRANA/5-183,RL13_TOBAC/1-179)),RL13B_YEAST/7-173);
DTL  2.2179
RID  0.537659
RPH  ((((RL13_SCHMA/6-184:0.37663,RL13B_YEAST/7-173:0.51984):0.07761,RL13_CHICK/6-184:0.23725):0.09152,RL13_DROME/6-185:0.26886):0.34202,RL131_BRANA/5-183:0.10899,RL13_TOBAC/1-179:0.28465);
RTP  ((((RL13_SCHMA/6-184,RL13B_YEAST/7-173),RL13_CHICK/6-184),RL13_DROME/6-185),RL131_BRANA/5-183,RL13_TOBAC/1-179);
RTL  2.31356
LNK  RL131_BRANA/5-183:P41128:Z22618
LNK  RL13B_YEAST/7-173:P40212:Z47071
LNK  RL13_CHICK/6-184:P41125:D26318
LNK  RL13_DROME/6-185:P41126:X77926
LNK  RL13_SCHMA/6-184:Q95043:U57003
LNK  RL13_TOBAC/1-179:P49627:L31416
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  RL13_TOBAC/1-179
ASQ  MYSANGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRRASRSRLVILPPRNCLTATQVHGAYMPIER-EKHQLILSKVLKKMKSFNAYAKLRVE
DSQ  ATGTACTCCGCGAATGGACACTTCAAGAAGCACTGGCAGAACTATGTGAAGACATGGTTCAATCAGCCAGCACGCAAGACCAGGAGAAGAATTGCAAGACAAAAGAAGGCTGTCAAGATTTCCCCCAGACCAACTGCTGGAACTCTTCGACCTATTGTCCATGGTCAGACACTCAAATACAACATGAAAGTTAGGTCTGGTAGAGGATTCTCCCTTGAGGAACTCAAGGCTGCAGGTATCCCTAAGAAACTGGCTCCAACAATTGGTATTGCGGTTGATCATCGTCGCAGGAATCGGTCACTTGAGGGGCTTCAAACTAATGTTCAAAGGTTGGAGGACCTACAAGGCCAATTAGTCGTCTTCCCAAGACGTGCTTCCAGGTCAAGGCTGGTGATTCTGCCCCCGAGGAATTGCCTCACGGCAACTCAAGTCCATGGTGCTTACATGCCTATTGAACGT---GAGAAGCATCAGTTGATCTTGTCCAAGGTTCTGAAGAAGATGAAGTCGTTCAATGCCTATGCCAAGCTACGTGTGGAG
TRN  10010101100011000
NAM  RL131_BRANA/5-183
ASQ  NVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVR-EKHATELVKLTTEMKSVKAFDKIRLE
DSQ  AATGTCATCCCCAATGGTCATTTCAAGAAGCACTGGCAGAACTATGTCAAGACTTGGTTCAACCAGCCTGCCAGGAAAACCAGGAGAAGAGTTGCGAGACAAAAGAAGGCTGTGAAGATCTTCCCCCGTCCCACTGCTGGACCTCTTCGCCCTGTTGTGCATGGTCAGACTCTCAAGTACAACATGAAGGTCCGAACCGGTAAAGGTTTCACTCTTGAAGAGCTCAAGTCTGCTGGAATCCCCAAGAAGTTGGCACCAACCATTGGTATCGCTGTTGACCATCGCCGGAAGAACAGATCTCTCGAGGGTCTTCAGTCCAATGTCCAGAGGCTCAAAACCTACAAGGCTAAGTTGGTCATCTTCCCGCGTCGTGCCAGGAAGGTCAAGGCTGGTGATTCTACTGCAGAAGAGTTGGCCAATGCCACTCAAGTCCAAGGGGACTACATGCCTATTGTCCGT---GAGAAGCATGCTACAGAGCTTGTGAAGCTGACAACTGAGATGAAATCAGTCAAGGCTTTTGACAAAATCCGTCTGGAG
TRN  10010101100011001
NAM  RL13_SCHMA/6-184
ASQ  DVLHHNHFRKKWQFMVKTWFNQPARKERRRQARKAKAQRIAPRPASGPLRPIVNCPTFRYNMKVRSGRGFSLQEVRAAGLNPKFARTIGIAVDHRRRNVSVEGLQRNVARLKAYKAKLILFPLNPAKPQAMDAKADEVKKATQLRRPVLPITQ-RAKRLKAHKPTSSELRYSAFHAIRQQ
DSQ  GATGTTCTGCATCACAACCACTTCAGAAAAAAGTGGCAATTTATGGTGAAAACATGGTTCAACCAACCAGCACGCAAAGAACGCAGACGACAGGCTAGAAAAGCTAAAGCTCAACGAATCGCACCGAGGCCAGCTTCTGGTCCACTTCGACCTATTGTCAACTGTCCAACATTCCGATACAATATGAAAGTAAGATCAGGGCGTGGATTCTCATTGCAAGAAGTGCGCGCAGCCGGTCTGAATCCAAAATTCGCCCGCACTATTGGGATAGCCGTTGATCACCGTCGACGAAACGTCTCTGTCGAAGGGCTACAAAGAAATGTTGCTCGACTCAAAGCATACAAAGCTAAACTCATACTGTTCCCTCTAAATCCAGCGAAGCCTCAGGCCATGGATGCAAAGGCCGACGAGGTTAAGAAGGCCACACAACTCCGCCGACCGGTGCTCCCTATTACTCAA---AGAGCAAAACGTTTGAAGGCCCACAAACCAACATCGTCTGAACTAAGGTACAGCGCCTTCCATGCCATCCGTCAGCAA
TRN  10010101100011001
NAM  RL13_DROME/6-185
ASQ  NMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKA
DSQ  AATATGATTCCGAATCAGCACTACCACAAGTGGTGGCAGCGGCATGTGAAGACCTGGTTCAACCAGCCGGCCCGCAAGGTCCGCAGGCATGCGAACCGCGTCAAGAAGGCTAAGGCCGTCTTCCCCCGCCCAGCCAGCGGTGCCCTGCGCCCTGTGGTTCGCTGCCCCACCATCCGCTACCACACCAAGCTGCGTGCCGGCCGTGGTTTCACCCTGGAGGAGCTGAAGGGTGCCGGCATTGGCGCCAACTTCGCCAAGACCATCGGCATTGCCGTCGACAGGAGGCGCAAGAACAAATCCCTGGAGTCCCGCCAGCGTAACATCCAGCGCCTCAAGGAGTACCGCAGCAAGTTGATCCTGTTCCCCATCAACGAGAAGAAGATCCGCGCCGGCGAGTCCTCTCTGGAGGAGTGCAAGCTGGCTACCCAGCTTAAGGGACCCGTCCTGCCCATCAAAAATGAGCAGCCCGCCGTGGTCGAGTTCCGTGAGGTGACCAAGGATGAGAAGAAGTTCAAGGCCTTCGCCACGCTGCGCAAGGCT
TRN  10010101100011011
NAM  RL13_CHICK/6-184
ASQ  GMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVRYHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRN-VFKREKARVISEEEKNFKAFASLRMA
DSQ  GGCATGATCCTGAAGCCGCACTTCCACAAGGACTGGCAGCGACGAGTGGCCACATGGTTCAACCAGCCGGCCCGCAAGATCCGCAGGAGGAAGGCCCGCCAGGCAAAGGCTCGTCGCATCGCGCCCCGCCCTGTGGCTGGGCCCATCCGGCCCATCGTGAGGTGCCCGACTGTCAGATACCACAAAAAAGTTCGTGCTGGCAGAGGATTCAGCCTAGAAGAGCTTAAACTGGCGGGCATTAACAAAAGGTTTGCTCGGACGATTGGAATCTCCGTGGATCCCAGGCGAAGAAACAAATCTACAGAGTCACTGCAAGCCAACGTGCAGCGGCTGAAGGAGTATCGCTCCAAGCTTATCCTCTTCCCAAGGAAGCCGTCTGCACCGAAGAAAGGAGACAGCTCTCCTGAGGAACTCAAGATGGCAACTCAGCTGTCCGGACCGGTTATGCCGATCAGGAAC---GTTTTCAAACGGGAGAAGGCCCGTGTTATCTCAGAGGAGGAGAAGAACTTCAAGGCCTTTGCCAGCCTGCGCATGGCC
TRN  10010101100011001
NAM  RL13B_YEAST/7-173
ASQ  LPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLD-LLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKIIVFPRDGKAP-----EAEQVLSAAAT----FPIAQ-PATDVEARAVQDNGE--SAFRTLRLA
DSQ  TTACCAATTTTGAAGAACCACTTCAGAAAGCACTGGCAAGAACGTGTCAAGGTTCACTTTGACCAAGCTGGTAAAAAGGTTTCTAGACGTAATGCTAGAGCTGCCAGAGCCGCCAAGATTGCTCCAAGACCATTGGAT---TTGTTGAGACCTGTTGTCAGAGCTCCAACTGTTAAGTACAACAGAAAGGTTAGAGCTGGTAGAGGTTTCACCTTGGCTGAAGTTAAGGCCGCTGGTTTGACTGCTGCTTACGCCAGAACCATTGGTATTGCTGTTGACCACAGACGTCAAAACAGAAACCAAGAAATCTTTGACGCTAACGTTCAAAGATTGAAGGAGTACCAATCCAAGATTATCGTTTTCCCAAGAGACGGTAAGGCTCCA---------------GAAGCTGAACAAGTTTTGTCTGCTGCTGCCACT------------TTCCCAATTGCTCAA---CCAGCTACCGATGTTGAAGCTAGAGCTGTTCAAGACAATGGTGAA------TCTGCTTTCAGAACCTTGAGATTAGCC
TRN  10110101110011010
//