EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01287 - eIF-5a)
FAM  PF01287
PID  eIF-5a
DES  Eukaryotic initiation factor 5A hypusine, DNA-binding OB fold
IPR  IPR001884
ANO  8
ALN  72
AID  0.346721
APH  ((IF5A1_TOBAC/85-154:0.54184,(IF5A1_YEAST/83-150:0.36955,IF5A_NEUCR/90-157:0.65453):0.00000):0.08724,IF5A1_CHICK/83-150:0.35316,(IF5A1_CAEEL/87-156:0.65674,(IF5A_DICDI/98-165:0.10045,(IF5A_METJA/70-129:0.53253,IF5A_SULAC/69-131:0.60504):1.52757):0.30452):0.12310);
ATP  ((IF5A1_TOBAC/85-154,(IF5A1_YEAST/83-150,IF5A_NEUCR/90-157)),IF5A1_CHICK/83-150,(IF5A1_CAEEL/87-156,(IF5A_DICDI/98-165,(IF5A_METJA/70-129,IF5A_SULAC/69-131))));
ATL  5.85627
DNO  6
DLN  216
DID  0.480763
DPH  ((IF5A_NEUCR/90-157:0.33461,IF5A_METJA/70-129:1.12667):0.12953,IF5A1_YEAST/83-150:0.16553,((IF5A1_CHICK/83-150:0.32353,IF5A_DICDI/98-165:0.33499):0.05838,IF5A1_TOBAC/85-154:0.49666):0.10058);
DTP  ((IF5A_NEUCR/90-157,IF5A_METJA/70-129),IF5A1_YEAST/83-150,((IF5A1_CHICK/83-150,IF5A_DICDI/98-165),IF5A1_TOBAC/85-154));
DTL  3.07048
RID  0.389301
RPH  ((IF5A_DICDI/98-165:0.11775,IF5A_METJA/70-129:2.14092):0.40040,(IF5A1_TOBAC/85-154:0.54673,(IF5A1_YEAST/83-150:0.39195,IF5A_NEUCR/90-157:0.66508):0.00000):0.08503,IF5A1_CHICK/83-150:0.31944);
RTP  ((IF5A_DICDI/98-165,IF5A_METJA/70-129),(IF5A1_TOBAC/85-154,(IF5A1_YEAST/83-150,IF5A_NEUCR/90-157)),IF5A1_CHICK/83-150);
RTL  4.6673
LNK  IF5A1_CAEEL/87-156:P34563:
LNK  IF5A1_CHICK/83-150:Q07460:M99499
LNK  IF5A1_TOBAC/85-154:P69040:X63543
LNK  IF5A1_YEAST/83-150:P19211:J05455
LNK  IF5A_DICDI/98-165:P13651:X14970
LNK  IF5A_METJA/70-129:Q58625:U67563
LNK  IF5A_NEUCR/90-157:P38672:U02638
LNK  IF5A_SULAC/69-131:P28461:
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  IF5A_SULAC/69-131
ASQ  IIEKHVGQILADK-GDNLTIMDL---ESYETFDLEKPT--ENEIVSKIRPGA---EIEYWSVMGRRKIVRVK
NAM  IF5A_METJA/70-129
ASQ  IIDRRKGQVLAIM-GDMVQIMDL---QTYETLELPIPE----GIEGLEPGGE----VEYIEAVGQYKITRVI
DSQ  ATAATTGACAGAAGAAAAGGACAAGTATTGGCTATAATG---GGAGATATGGTTCAAATTATGGACTTG---------CAAACTTACGAAACATTGGAGTTGCCAATTCCAGAA------------GGTATTGAAGGATTAGAGCCAGGAGGAGAA------------GTTGAATATATAGAAGCAGTTGGTCAATACAAGATAACAAGAGTTATT
TRN  10010101110011010
NAM  IF5A_NEUCR/90-157
ASQ  NVKRTDYQFSYID-EDFLVLIDS-NGEEKRELKMPEGE-LAKRIEKLEEEGK-DFFVGVQTAMGEEAAIDVK
DSQ  AACGTCAAGCGCACCGACTACCAGTTCTCCTACATCGAC---GAGGACTTCCTTGTCCTTATTGACTCC---AACGGTGAGGAGAAGCGTGAGCTCAAGATGCCCGAGGGTGAG---CTTGCCAAGCGCATTGAGAAGCTCGAGGAGGAGGGCAAG---GACTTCTTCGTCGGTGTCCAGACCGCCATGGGTGAGGAGGCTGCCATCGATGTCAAG
TRN  11011111111111111
NAM  IF5A_DICDI/98-165
ASQ  NVSRKEYTVMDVQ-DGYLSLLDA-GGEVKEDLALPEDD-IGKEITQMLKEGK-EPLVSVISALGKEGVVSVK
DSQ  AATGTCAGCAGAAAGGAATACACCGTTATGGATGTTCAA---GATGGTTACTTATCACTCTTGGATGCT---GGTGGTGAAGTCAAAGAAGATCTTGCCCTCCCAGAAGATGAT---ATTGGTAAAGAAATTACCCAAATGTTAAAAGAAGGTAAA---GAGCCATTAGTTTCAGTCATCTCTGCTTTAGGTAAAGAAGGTGTCGTCTCTGTTAAA
TRN  10010101110011000
NAM  IF5A1_YEAST/83-150
ASQ  FVKRSEYQLLDID-DGYLSLMTM-DGETKDDVKAPEGE-LGDSMQAAFDEGK-DLMVTIISAMGEEAAISFK
DSQ  TTTGTCAAGAGAAGCGAATACCAATTGTTGGATATTGAT---GATGGCTACTTGTCCTTGATGACCATG---GACGGTGAAACCAAAGACGATGTCAAGGCACCAGAAGGTGAA---TTGGGTGACAGCATGCAAGCTGCTTTCGATGAAGGTAAG---GATTTGATGGTCACTATCATTTCTGCCATGGGTGAAGAAGCTGCCATCTCCTTCAAG
TRN  10110101110011011
NAM  IF5A1_TOBAC/85-154
ASQ  HVNRTDYQLIDISEDGFVSLLTE-NGNTKDDLRLPTDDNLLALIKDGFAEGK-DLVLSVMSAMGEEQICGIK
DSQ  CATGTGAATAGGACTGACTATCAGCTTATTGATATCTCTGAGGATGGATTTGTGAGTCTGTTGACTGAA---AATGGTAACACCAAGGATGACTTGAGGCTCCCAACTGACGATAATCTTCTGGCCCTGATCAAAGATGGTTTTGCTGAGGGGAAG---GACCTGGTTCTGTCAGTGATGTCTGCCATGGGAGAGGAGCAGATTTGTGGTATCAAG
TRN  10010101100011001
NAM  IF5A1_CHICK/83-150
ASQ  NIKRNDYQLIGIQ-DGYLSLLTE-SGEVREDLKLPEGD-LGKEIEGKFNANE-DVQISVISAMNEECAVAIK
DSQ  AATATAAAGAGGAACGACTACCAGCTGATAGGGATTCAG---GATGGGTACCTCTCCCTGCTGACAGAA---AGTGGCGAAGTTCGTGAGGATCTAAAGCTGCCAGAAGGTGAT---CTGGGAAAAGAAATAGAAGGAAAGTTCAATGCCAATGAA---GATGTGCAGATATCCGTCATAAGTGCAATGAATGAAGAATGTGCTGTAGCCATAAAG
TRN  10010101100011011
NAM  IF5A1_CAEEL/87-156
ASQ  VVKRREYILMSIE-DGFCSLMDPESCELKDDLKMPEGD-LGNTIREALEKDEGSVLVQVVAACGEEAILGYK
//