EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF01272 - GreA_GreB)
FAM  PF01272
PID  GreA_GreB
DES  Prokaryotic transcription elongation factor, GreA/GreB, C-terminal domain
IPR  IPR001437
ANO  8
ALN  81
AID  0.371582
APH  (((GREA_HELPY/80-156:0.60246,((GREA_ECOLI/80-157:0.15228,GREA_HAEIN/80-157:0.17196):0.17239,GREA_RICPR/81-157:0.57041):0.08273):0.18834,(GREA_MYCLE/81-161:1.72274,GREA_MYCGE/83-160:1.32273):0.00000):0.45870,GREB_ECOLI/80-155:0.47239,GREB_HAEIN/81-156:0.21456);
ATP  (((GREA_HELPY/80-156,((GREA_ECOLI/80-157,GREA_HAEIN/80-157),GREA_RICPR/81-157)),(GREA_MYCLE/81-161,GREA_MYCGE/83-160)),GREB_ECOLI/80-155,GREB_HAEIN/81-156);
ATL  6.24408
DNO  8
DLN  243
DID  0.452739
DPH  ((GREB_ECOLI/80-155:0.36932,GREB_HAEIN/81-156:0.23060):0.29151,(GREA_RICPR/81-157:0.31780,GREA_MYCGE/83-160:0.81661):0.10079,((GREA_ECOLI/80-157:0.24764,(GREA_MYCLE/81-161:1.26674,GREA_HAEIN/80-157:0.05354):0.13258):0.04866,GREA_HELPY/80-156:0.53010):0.12860);
DTP  ((GREB_ECOLI/80-155,GREB_HAEIN/81-156),(GREA_RICPR/81-157,GREA_MYCGE/83-160),((GREA_ECOLI/80-157,(GREA_MYCLE/81-161,GREA_HAEIN/80-157)),GREA_HELPY/80-156));
DTL  4.5345
RID  0.371582
RPH  (((GREA_HELPY/80-156:0.60246,((GREA_ECOLI/80-157:0.15228,GREA_HAEIN/80-157:0.17196):0.17239,GREA_RICPR/81-157:0.57041):0.08273):0.18834,(GREA_MYCLE/81-161:1.72274,GREA_MYCGE/83-160:1.32273):0.00000):0.45870,GREB_ECOLI/80-155:0.47239,GREB_HAEIN/81-156:0.21456);
RTP  (((GREA_HELPY/80-156,((GREA_ECOLI/80-157,GREA_HAEIN/80-157),GREA_RICPR/81-157)),(GREA_MYCLE/81-161,GREA_MYCGE/83-160)),GREB_ECOLI/80-155,GREB_HAEIN/81-156);
RTL  6.24408
LNK  GREA_ECOLI/80-157:P21346:X54718
LNK  GREA_HAEIN/80-157:P43881:U32812
LNK  GREA_HELPY/80-156:P64275:AE000596
LNK  GREA_MYCGE/83-160:P47524:U39708
LNK  GREA_MYCLE/81-161:P46808:AL583925
LNK  GREA_RICPR/81-157:P27640:Z12122
LNK  GREB_ECOLI/80-155:P30128:U81522
LNK  GREB_HAEIN/81-156:P43882:U32738
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  GREB_HAEIN/81-156
ASQ  KQEG-KVFFGAWVELENEEGETK-QYRIVGCDE--FAPAKNWISIDSPVARALIGKTLDDEVRVETPSG-FITLYVNKIWY
DSQ  AAGCAAGAGGGA---AAAGTTTTCTTCGGTGCGTGGGTGGAATTAGAAAATGAAGAAGGCGAAACCAAG---CAATATCGTATCGTCGGTTGTGATGAA------TTTGCCCCTGCGAAAAATTGGATATCCATTGATTCCCCAGTTGCTCGAGCTTTAATCGGAAAAACATTAGACGACGAAGTGCGGGTAGAAACGCCCTCAGGT---TTTATCACACTTTATGTGAATAAAATTTGGTAT
TRN  10010101110011000
NAM  GREB_ECOLI/80-155
ASQ  QQEG-KVFFGAWVEIENDDGVTH-RFRIVGYDE--IFGRKDYISIDSPMARALLKKEVGDLAVVNTPAG-EASWYVNAIEY
DSQ  CAGCAGGAAGGC---AAAGTCTTTTTTGGCGCGTGGGTGGAGATTGAAAACGACGATGGCGTGACTCAC---CGTTTCCGTATTGTCGGCTACGATGAA------ATTTTTGGCCGTAAAGATTACATCTCTATCGATTCCCCGATGGCCCGCGCATTGCTGAAAAAAGAAGTCGGCGATCTGGCGGTGGTGAATACCCCTGCCGGG---GAAGCGAGCTGGTATGTTAATGCTATCGAGTAC
TRN  11011101101011011
NAM  GREA_RICPR/81-157
ASQ  LSGD-NIKFGATVTLIDDDTEEEVTYIIVGEYE--ADITKKRVSIASPIAKALIGKSVGDFVEVTTPKG-LKSYEVVTVEY
DSQ  TTATCGGGAGAT---AACATAAAATTTGGAGCTACTGTTACTTTAATCGACGACGATACTGAAGAAGAAGTAACATATATTATTGTAGGAGAATATGAA------GCCGATATAACTAAAAAAAGAGTTTCAATCGCTTCTCCTATAGCCAAAGCTTTAATTGGAAAATCAGTAGGTGATTTTGTAGAAGTCACAACACCAAAAGGA---TTAAAATCATACGAAGTAGTTACCGTTGAATAT
TRN  10010101110011000
NAM  GREA_HELPY/80-156
ASQ  LAHN-KVSFGSTIKILNLDNDKEFSYTIVGSVE--SDPAKGLISFGSPIAKSLIGKSKGDAVSIQLPNG-ESDFEILDIYY
DSQ  TTAGCCCATAAT---AAAGTGAGTTTTGGTAGCACGATTAAAATTCTTAATTTAGACAACGATAAAGAGTTTTCTTACACGATAGTAGGGAGCGTGGAG------AGTGATCCGGCTAAAGGGTTAATCTCTTTTGGTTCGCCGATCGCTAAGAGTTTGATAGGCAAGAGCAAGGGCGATGCGGTGAGCATTCAATTGCCTAATGGC---GAAAGCGATTTTGAAATTTTAGACATTTATTAT
TRN  10010101110011010
NAM  GREA_HAEIN/80-157
ASQ  MPNNGKVIFGATVVLVNTNTDEEVTYRIVGDDE--ADIKSGLISVNSPIARGLIGKELDDTVNITTPGG-VVEFDIIEVNY
DSQ  ATGCCAAATAATGGTAAAGTGATTTTTGGTGCAACAGTTGTGCTTGTAAATACAAATACAGACGAAGAAGTCACTTATCGCATTGTAGGCGATGATGAG------GCTGATATTAAATCTGGTTTAATTTCGGTTAATTCACCAATTGCGCGAGGCTTAATTGGTAAAGAATTAGATGATACCGTTAATATTACAACGCCTGGTGGT---GTCGTTGAATTTGATATTATTGAAGTGAATTAT
TRN  11011101111011000
NAM  GREA_ECOLI/80-157
ASQ  MPNNGRVIFGATVTVLNLDSDEEQTYRIVGDDE--ADFKQNLISVNSPIARGLIGKEEDDVVVIKTPGG-EVEFEVIKVEY
DSQ  ATGCCCAACAATGGGCGCGTTATTTTTGGTGCTACCGTAACGGTGCTGAATCTGGATTCTGACGAAGAACAGACTTATCGCATCGTTGGCGATGACGAA------GCTGACTTTAAACAAAACCTGATTTCTGTAAACTCGCCTATTGCTCGTGGCCTGATCGGCAAAGAAGAAGATGATGTTGTGGTCATCAAAACGCCGGGCGGC---GAAGTAGAATTTGAAGTAATTAAGGTGGAATAC
TRN  11011101101011011
NAM  GREA_MYCGE/83-160
ASQ  KTKVTKVSLGSTVEIYDYSSKSNEKYTIVGTLE--ANPEEHKISNESPLALAIYGRLIGDECDVVGIEV-PYRVKILKISN
DSQ  AAAACCAAAGTAACAAAAGTTAGCTTAGGGAGCACTGTTGAGATCTATGATTACAGTTCTAAATCGAACGAAAAATACACAATTGTAGGTACACTTGAA------GCAAATCCTGAAGAACACAAAATTTCCAATGAATCACCCCTTGCCCTTGCAATCTATGGGCGTTTAATTGGTGATGAATGTGATGTTGTTGGTATTGAAGTT---CCCTATCGTGTTAAAATCCTGAAGATCAGCAAC
TRN  11011101101011000
NAM  GREA_MYCLE/81-161
ASQ  KQSGVALPGSVVKVYYNDDKSDTETFLIATRQEGVNEGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGNTVQVTLISAEP
DSQ  AAGCAGTCCGGCGTGGCGCTGCCCGGTTCGGTGGTCAAGGTCTACTACAACGACGACAAGTCCGACACCGAGACATTCCTCATAGCCACTCGCCAGGAGGGCGTCAACGAGGGCAAGCTCGAGGTTTACTCGCCAAATTCACCACTGGGGGGCGCCCTGATCGACGCCAAGGTGGGTGAGACTCGCAGCTACACCGTACCCAATGGCAACACCGTTCAAGTCACGTTGATCAGCGCTGAGCCT
TRN  10010111100111001
//